beautiful ben big blue bridge by cerney city color colors county dark darkness england eye image images lake light lights london nei1523 neil night nightime photos pickin pickinimages playing reading refelction river shutter silhouette sky slow slowshutterspeed south speed speeds sunset thames uk water with

Pickin Images ( User ) Flickr Hive Mind Users: Pickin Images (more)  Preferences 
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Advanced 

I am a fan of Nicole Atkins's Music. Check her out!

-Nathan

 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/User/Pickin Images Hits: 82 Pages: 2 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
Westminster 2 (Pickin Images) Tags: county city uk bridge blue winter england color building london college colors beautiful by architecture night composition buildings wonderful dark landscape town big long cityscape colours darkness angle image flood ben photos britain weekend south awesome centre low capital central cities trails cityscapes neil kingdom center images architectural clear nightime hour architektur british lovely metropolitan refelction pickin bight cites cerney pickinimages nei1523
London Eye and County Hall (Pickin Images) Tags: county old bridge blue light sunset england sky house lake playing london eye tower clock beautiful westminster wheel silhouette by thames night river dark lights hall big exposure slow with riverside image little ben photos shaped south flight shapes fast neil sunny images explore nightime headlight parliment refelction pickin speeds slowshutterspeed refelection refelections cerney pickinimages nei1523
Tower Bridge (Pickin Images) Tags: park old city bridge blue trees winter light sea england sky people house lake playing black tree green london tower castle water beautiful up field silhouette yellow rock thames night speed river dark lights golden boat big pub focus rocks soft long exposure day silent slow motorway little south small central shapes fast neil clear hour shutter shallow framing milky refelction pickin speeds raised slowshutterspeed refelection bight refelections cerney
Westminster (Pickin Images) Tags: county city uk bridge blue winter england color building london college colors beautiful by architecture night composition buildings wonderful dark landscape town big long cityscape colours darkness angle image flood ben photos britain weekend south awesome centre low capital central cities trails cityscapes neil kingdom center images architectural clear nightime hour architektur british lovely metropolitan refelction pickin bight cites cerney pickinimages nei1523
Trafalgar Square (Pickin Images) Tags: road street city trip travel blue light vacation sky urban holiday color building london art tourism glass lamp colors architecture modern night composition buildings wonderful square point photography photo office europe cityscape colours view angle image artistic weekend gorgeous south awesome centre capital wide perspective picture cities cityscapes trafalgar neil pic center architectural more foster future stunning excellent nights metropolis unusual lovely alpha fabulous avenue pickin municipality cerney greatphotographers flickrsbest coth5 theoriginalgoldseal flickrsportal
London Eye 2 (Pickin Images) Tags: county city uk bridge blue winter england color building london eye college colors beautiful by architecture night composition buildings wonderful dark landscape town big long cityscape colours darkness angle image flood ben photos britain weekend south awesome centre low capital central cities trails cityscapes neil kingdom center images architectural clear nightime hour architektur british lovely metropolitan refelction pickin bight cites cerney pickinimages nei1523
St. Pauls HDR (Pickin Images) Tags: city uk travel urban color building london colors st by architecture night buildings reflections dark spectacular photography lights photo interestingness cityscape darkness cathedral image photos dusk south centre cities cityscapes neil pauls landmark center icon images structure architectural explore nighttime nightime finepix londres architektur nights fujifilm sensational metropolis londra impressive nightfall pickin municipality edifice cites cerney s6500fd s6000fd paulsthames pickinimages nei1523
Tower Bridge of London City (Pickin Images) Tags: old city bridge light england sky people playing tree london eye tower castle water car wheel silhouette st by thames night docks river reading lights golden big rocks long slow with heart motorway image ben photos south trails fast neil images nightime shutter ark pickin slowshutterspeed cerney kathrines pickinimages nei1523
Big Ben Gemma (Pickin Images) Tags: county old bridge blue light sunset england sky house lake playing london eye tower clock beautiful westminster wheel silhouette by thames night river dark lights hall big exposure slow with riverside image little ben photos shaped south flight shapes fast neil sunny images explore nightime headlight parliment refelction pickin speeds slowshutterspeed refelection refelections cerney pickinimages nei1523
Wilton Windmill ~Explored #7~ (Pickin Images) Tags: county city uk light sunset england sky lake color london eye colors field silhouette speed dark reading boat big long slow with darkness weekend quality south neil cotswolds images shutter portsmouth wiltshire refelction pickin speeds wilton slowshutterspeed cotswold petworth windmil cerney westonbrit pickinimages
Draft Edit number 2 (Pickin Images) Tags: show new city uk bridge blue sunset 2 england sky cloud house london eye tower college colors beautiful westminster by thames night composition digital speed docks canon buildings john river lens photography for hotel is big cityscape slow ben 10 year capital lakes landmarks neil slide images 2nd created nightime level hour shutter stunning barrier canary slideshow 1855 feb standard ponds submission ogden due pickin 2012 guilds bracknell refelection wokingham lovley 400d
St. Pauls HDR (Pickin Images) Tags: city uk travel urban color building london colors st by architecture night buildings reflections dark spectacular photography lights photo interestingness cityscape darkness cathedral image photos dusk south centre cities cityscapes neil pauls landmark center icon images structure architectural explore nighttime nightime finepix londres architektur nights fujifilm sensational metropolis londra impressive nightfall pickin municipality edifice cites cerney s6500fd s6000fd paulsthames pickinimages nei1523
Canary Wharf & The O2 (Pickin Images) Tags: london by night image photos south neil images nightime pickin cerney pickinimages nei1523
EcCeL MARINA & The O2 (Pickin Images) Tags: city urban orange london colors by night marina dark spectacular geotagged photo dock arquitectura cityscape darkness skyscrapers image photos dusk south centre towers o2 cities royal cityscapes neil millenium center images victoria chain melody part nighttime 350 ii nightime wharf dome londres nights sensational metropolis canary alpha londra metropolitan impressive global nightfall pickin excel municipality cites unchained cerney panoramafotogrfico saariysqualitypictures pickinimages nei1523
Barrier & O2 (Pickin Images) Tags: light sky cloud reflection london beach water by night river landscape long exposure ray nightshot image flood photos south tide low o2 neil images explore shore nightime wise barrier xo hdr foreshore pickin congrats londonist cerney londonistriverproject pickinimages nei1523
Big Ben (Pickin Images) Tags: county old bridge blue light sunset england sky house lake playing london eye tower clock beautiful westminster wheel silhouette by thames night river dark lights hall big exposure slow with riverside image little ben photos shaped south flight shapes fast neil sunny images explore nightime headlight parliment refelction pickin speeds slowshutterspeed refelection refelections cerney pickinimages nei1523
St. Katharine Docks, London UK (Pickin Images) Tags: city uk bridge blue sunset england house london eye tower water wheel st by thames skyline night marina docks river boats pier big twilight europe european view riverside image suspension ben photos britain dusk south united capital great scenic ivory cities neil kingdom landmark images tourist nightime hour esplanade promenade british yachts katharine wetdock pickin cerney kathrines pickinimages nei1523
Dinton Pastures (Pickin Images) Tags: sunset lake london water birds by night reading boat pond image photos south neil images gemma swans nightime pastures launch berkshire decking pickin dinton cerney 1523 pickinimages nei1523
Dinton Pastures (Pickin Images) Tags: sunset lake london water birds by night reading boat pond image photos south neil images gemma swans nightime pastures launch berkshire decking pickin dinton cerney 1523 virgiliocompany pickinimages nei1523
Dinton Pastures (Pickin Images) Tags: sunset lake london water birds by night reading boat pond image photos south neil images gemma swans nightime pastures launch berkshire decking pickin dinton cerney 1523 pickinimages nei1523
Dinton Pastures (Pickin Images) Tags: sunset london by night reading image photos south neil images gemma nightime berkshire pickin dinton cerney pickinimages hardingmorris nei1523
Slowing Falls *EXPLORED* (Pickin Images) Tags: light white lake playing london water beautiful by night speed river waterfall slow with image photos south neil images nightime shutter l milky virgina pickin speeds slowshutterspeed cerney cascaded pickinimages nei1523
Moonphase (Pickin Images) Tags: moon london by night canon video play with shot image zoom photos south first neil images nightime dslr mode pickin cerney moonphase 600d my pickinimages nei1523
Shiplake Boatyard *EXPLORED* (Pickin Images) Tags: old bridge light sunset summer sky lake playing tree london water beautiful field silhouette by thames night speed river dark reading lights golden boat canal rocks slow with heart image photos south fast neil sunny images nightime shutter ark berkshire avon pickin speeds slowshutterspeed malard cerney pickinimages nei1523
Tree of Silhouette (Pickin Images) Tags: old sunset summer sky tree london beautiful silhouette by night dark golden image photos south neil images nightime pickin cerney pickinimages nei1523
Virgina Water Cascade (Pickin Images) Tags: light white lake playing london water beautiful by night speed river waterfall slow with image photos south neil images nightime shutter l berkshire milky virgina pickin speeds slowshutterspeed cerney cascaded pickinimages nei1523
Mate for Life (Pickin Images) Tags: life sunset lake river reading for spring pond heart wildlife south neil swans hart mate pickin cerney hosehill pickinimages
Ladybower Reservoir (Pickin Images) Tags: england game london motif by lady night bravo factory image photos district quality south peak neil images national nightime superhero trust friendly thumbsup challenge challenges bower pickin yourock the naturesfinest cerney bigmomma blueribbonwinner supershot magicdonkey specland specnature challengeyou challengeyouwinner anawesomeshot superaplus aplusphoto diamondclassphotographer flickrdiamond superhearts a3b challengefactory fotocompetitionbronze herowinner storybookwinner motifunam pickinimages nei1523
Twilight at Henley Bridge *EXPLORED* (Pickin Images) Tags: bridge light sunset people lake london castle water beautiful by thames night speed river dark reading lights coast boat canal duck pub rocks slow heart image photos seagull south neil images swans nightime shutter ark avon henley pickin speeds slowshutterspeed malard cerney pickinimages nei1523
Blue hour *EXPLORED* (Pickin Images) Tags: bridge sunset lake london water beautiful by thames night speed river reading lights boat duck pub slow image photos south trails neil images nightime shutter ark henley pickin speeds slowshutterspeed cerney pickinimages nei1523
Rush Hour *EXPLORED* (Pickin Images) Tags: sunset london eye cars water car wheel st by thames night docks river lights big image ben photos south trails neil images surrey nightime rush hour a3 pickin cerney kathrines pickinimages nei1523
Fly~By~Boat *EXPLORED* (Pickin Images) Tags: bridge light sunset lake playing bird london castle water beautiful by thames night speed river dark reading lights boat canal waterfall duck pub slow with motorway image photos seagull south trails fast neil sunny images nightime shutter berkshire m4 virgina pickin speeds slowshutterspeed malard cerney pickinimages nei1523
The Tiger Moth Wickenby Airport (Pickin Images) Tags: birthday london by night plane reflections airport image photos south tiger flight moth neil images nightime whitby morris harding pickin airfield niel cerney wickenby pickinimages nei1523
Pier 60, Florida (Pickin Images) Tags: london by night shopping image photos south livemusic neil images nightime environment snackbar pickin crafters cerney beachbars andtheview eventpavilion pickinimages sunsetcelebrationsrelaxandunwind asthesunsetshereareasuperwaytoendyourdayeverydayatclearwaterbeachitisacelebration asunsetcelebrationthroughouttheyear theeveningsunsetsaretreatedroyallywithafestivecrowdandartistsatclearwaterbeachspier60thepier60festivalvisitorscelebrateeachuniquegulfofmexicosunsetasafunandgrandoccasionthisstreetfestivalfeaturesartists andmusicalperformancesonclearwatersfamousfishingpierpier60visitorsandresidentscongregateeacheveningtosoakupthisfestiveenvironmentandenjoyoneofthebestspotsinfloridatowatchthesunsetpier60isa1 000footobservationandfishingareawithbaittackle andcoveredplaygroundforkidseachdayfromtwohoursbeforeuntiltwohoursaftersunsetartisansandperformersarefeaturedenjoythefun allforagreatpricefreeadditionally pier60offersaccesstogreatfinedining entertainmentandoutstandingwhitesandybeaches nei1523
Halloween (Pickin Images) Tags: london by night image photos south neil images nightime pickin cerney pickinimages nei1523
Pelican Panic (Pickin Images) Tags: london by night image photos south neil images nightime sometimes pickin cerney pickinimages bpleasefeelfreetocheckoutmyahrefhttpwwwfacebookcompagespickinimagesphotography141658385923405relnofollowfacebook afollowmeonahrefhttpstwittercomneil1523relnofollowtwitteraoraddmeasaflickrahrefhttpwwwflickrcompeopleneil1523searchpickinimagescontactabpelicansareverylargebirdswithverylong terminallyhooked billscharacterisedbytheattachmentofahugegularpouchtheslenderramiofthelowerbillandtheflexibletonguemusclesformthepouchintoabasketforcatchingfishand rainwatertheyhavealongneckandshortlegswithlargefeetalthoughtheyappearbulkytheyarerelativelylightbecauseofairpocketsintheskeletonandbeneaththeskinsothattheyfloathighinthewater6thetailisshortandsquare with20to24feathersthewingsarelongandbroad suitablyshapedforsoaringflight andhavetheunusuallylargenumberof30to35secondaryflightfeathersthesmallestspeciesisthebrownpelican smallindividualsofwhichcanbeaslittleas275kg6lb 106cm42inlong andcanhaveawingspanofaslittleas183m6ftthelargestisbelievedtobethedalmatian atupto15kg33lb 183cm72inlong withamaximumwingspanof3mnearly10fttheaustralianpelicanhasthelongestbillofanybird nei1523
Westonbrit (Pickin Images) Tags: county city uk light sunset england sky lake color london eye colors field silhouette by night speed dark reading big long slow with darkness image photos weekend quality south neil cotswolds images nightime shutter wiltshire refelction pickin speeds slowshutterspeed cotswold cerney westonbrit pickinimages nei1523
Seasons Colour (Pickin Images) Tags: county city uk light sunset england sky lake color london eye colors field silhouette by night speed dark reading big long slow with darkness image photos weekend quality south neil cotswolds images nightime shutter wiltshire refelction pickin speeds slowshutterspeed cotswold cerney westonbrit pickinimages nei1523
Folridian Pelican (Pickin Images) Tags: sky london water beautiful silhouette by night speed with image photos south neil sunny pelican images nightime shutter pickin cerney pickinimages nei1523
Harmonious! *EXPLORED* (Pickin Images) Tags: london by night image photos south neil images nightime pickin cerney pickinimages nei1523
Still Life *EXPLORED* (Pickin Images) Tags: london by night image photos south neil images nightime pickin cerney pickinimages nei1523
Reedy Setting *EXPLORED* (Pickin Images) Tags: sunset lake london water beautiful by night speed reeds reading duck pond with image photos south neil sunny images nightime shutter berkshire pickin speeds reedy malard cerney hosehill pickinimages nei1523
River Of Lanterns (Pickin Images) Tags: london by night image photos south neil images nightime pickin cerney pickinimages nei1523
Wings *EXPLORED* (Pickin Images) Tags: bridge lake playing bird london castle by wales night speed canal with image photos seagull south flight fast neil sunny images nightime shutter avon pickin speeds cerney pickinimages nei1523
Coate Water (Pickin Images) Tags: london by night image photos south neil images nightime pickin cerney pickinimages nei1523
_MG_2032 (Pickin Images) Tags: london by night image photos south neil images nightime sometimes pickin cerney pickinimages bpleasefeelfreetocheckoutmyahrefhttpwwwfacebookcompagespickinimagesphotography141658385923405relnofollowfacebook afollowmeonahrefhttpstwittercomneil1523relnofollowtwitteraoraddmeasaflickrahrefhttpwwwflickrcompeopleneil1523searchpickinimagescontactabpelicansareverylargebirdswithverylong terminallyhooked billscharacterisedbytheattachmentofahugegularpouchtheslenderramiofthelowerbillandtheflexibletonguemusclesformthepouchintoabasketforcatchingfishand rainwatertheyhavealongneckandshortlegswithlargefeetalthoughtheyappearbulkytheyarerelativelylightbecauseofairpocketsintheskeletonandbeneaththeskinsothattheyfloathighinthewater6thetailisshortandsquare with20to24feathersthewingsarelongandbroad suitablyshapedforsoaringflight andhavetheunusuallylargenumberof30to35secondaryflightfeathersthesmallestspeciesisthebrownpelican smallindividualsofwhichcanbeaslittleas275kg6lb 106cm42inlong andcanhaveawingspanofaslittleas183m6ftthelargestisbelievedtobethedalmatian atupto15kg33lb 183cm72inlong withamaximumwingspanof3mnearly10fttheaustralianpelicanhasthelongestbillofanybird nei1523
Pier 60, Florida (Pickin Images) Tags: london by night shopping image photos south livemusic neil images nightime environment snackbar pickin crafters cerney beachbars andtheview eventpavilion pickinimages sunsetcelebrationsrelaxandunwind asthesunsetshereareasuperwaytoendyourdayeverydayatclearwaterbeachitisacelebration asunsetcelebrationthroughouttheyear theeveningsunsetsaretreatedroyallywithafestivecrowdandartistsatclearwaterbeachspier60thepier60festivalvisitorscelebrateeachuniquegulfofmexicosunsetasafunandgrandoccasionthisstreetfestivalfeaturesartists andmusicalperformancesonclearwatersfamousfishingpierpier60visitorsandresidentscongregateeacheveningtosoakupthisfestiveenvironmentandenjoyoneofthebestspotsinfloridatowatchthesunsetpier60isa1 000footobservationandfishingareawithbaittackle andcoveredplaygroundforkidseachdayfromtwohoursbeforeuntiltwohoursaftersunsetartisansandperformersarefeaturedenjoythefun allforagreatpricefreeadditionally pier60offersaccesstogreatfinedining entertainmentandoutstandingwhitesandybeaches nei1523
Westonbirt Aliens! (Pickin Images) Tags: london by night image photos south neil images nightime pickin cerney pickinimages nei1523
Durdle Door HDR2 ~Explored~ (Pickin Images) Tags: south neil pickin cerney
Fun at the Fair (Pickin Images) Tags: show old bridge blue winter light summer england sky orange playing london eye water silhouette yellow rock by skyline night speed dark lights big silent slow view image zoom photos weekend quality south wide neil slide images nightime wise shutter pickin speeds slowshutterspeed cerney theoriginalgoldseal pickinimages nei1523


page:          1        2      
size:     -      

50 neil pickin 49 south cerney 48 london 47 night 46 pickinimages images 45 image by nightime 44 nei1523 photos 20 sunset 19 lake 18 dark 17 water beautiful 16 light bridge slow shutter speeds river 15 speed sky england big with slowshutterspeed 14 reading city 13 lights 12 thames silhouette eye 11 colors playing blue 10 refelction ben uk 9 darkness county color boat long 8 old fast berkshire cityscape sunny weekend cities 7 trails centre cityscapes tower hour buildings center 6 explore architectural wheel capital building cites architecture house 5 winter flight pond refelection composition st quality castle swans exposure architektur field 4 central nights shapes colours british college photography municipality urban dusk gemma malard lovely heart westminster tree metropolis little riverside docks canal landscape photo rocks refelections flood pub golden metropolitan ark britain low dinton kingdom clear awesome bight wonderful angle duck 3 kathrines spectacular wiltshire 1523 westonbrit seagull birds landmark hall decking reflections clock people shaped headlight town nightfall parliment waterfall cotswolds view londra londres launch summer sensational virgina pastures travel impressive motorway avon nighttime milky cotswold fujifilm with20to24feathersthewingsarelongandbroad andcoveredplaygroundforkidseachdayfromtwohoursbeforeuntiltwohoursaftersunsetartisansandperformersarefeaturedenjoythefun eventpavilion orange crafters billscharacterisedbytheattachmentofahugegularpouchtheslenderramiofthelowerbillandtheflexibletonguemusclesformthepouchintoabasketforcatchingfishand bpleasefeelfreetocheckoutmyahrefhttpwwwfacebookcompagespickinimagesphotography141658385923405relnofollowfacebook suitablyshapedforsoaringflight atupto15kg33lb snackbar car sometimes 106cm42inlong cathedral pauls asunsetcelebrationthroughouttheyear skyline marina interestingness henley shopping edifice stunning cloud show andhavetheunusuallylargenumberof30to35secondaryflightfeathersthesmallestspeciesisthebrownpelican theoriginalgoldseal environment wise wide o2 andmusicalperformancesonclearwatersfamousfishingpierpier60visitorsandresidentscongregateeacheveningtosoakupthisfestiveenvironmentandenjoyoneofthebestspotsinfloridatowatchthesunsetpier60isa1 allforagreatpricefreeadditionally terminallyhooked canary rainwatertheyhavealongneckandshortlegswithlargefeetalthoughtheyappearbulkytheyarerelativelylightbecauseofairpocketsintheskeletonandbeneaththeskinsothattheyfloathighinthewater6thetailisshortandsquare pier60offersaccesstogreatfinedining sunsetcelebrationsrelaxandunwind icon paulsthames 000footobservationandfishingareawithbaittackle andcanhaveawingspanofaslittleas183m6ftthelargestisbelievedtobethedalmatian hosehill cascaded zoom s6500fd europe finepix canon slide bird yellow andtheview alpha livemusic afollowmeonahrefhttpstwittercomneil1523relnofollowtwitteraoraddmeasaflickrahrefhttpwwwflickrcompeopleneil1523searchpickinimagescontactabpelicansareverylargebirdswithverylong entertainmentandoutstandingwhitesandybeaches smallindividualsofwhichcanbeaslittleas275kg6lb theeveningsunsetsaretreatedroyallywithafestivecrowdandartistsatclearwaterbeachspier60thepier60festivalvisitorscelebrateeachuniquegulfofmexicosunsetasafunandgrandoccasionthisstreetfestivalfeaturesartists withamaximumwingspanof3mnearly10fttheaustralianpelicanhasthelongestbillofanybird beachbars white rock for s6000fd 183cm72inlong barrier asthesunsetshereareasuperwaytoendyourdayeverydayatclearwaterbeachitisacelebration silent l structure flickrdiamond melody m4 my shore specland flickrsportal superaplus life trees reedy superhero ray dome morris dock tide trust wharf 350 whitby artistic airport part peak xo slideshow bracknell harding motif pelican coast national challenge future supershot european avenue hart lovley moon ii petworth framing katharine diamondclassphotographer ogden 2nd global victoria created promenade saariysqualitypictures boats mode landmarks park submission day video airfield bigmomma twilight black mate tourist blueribbonwinner unchained birthday virgiliocompany herowinner hotel nightshot wildlife street tiger new john 400d greatphotographers challengeyouwinner bravo 600d

Pairs: 8 cerney,neil cerney,south neil,south neil,pickin pickin,south 7 neil,night pickinimages,south nei1523,south photos,pickinimages image,pickin images,london

Users: Pickin Images 50


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.