35 35mm abandoned autumn brick bw california canon colorful country creepy decay decoration fall film flowers grape grapes grapevines green horticulture leaf leaves light napavalley newyork old orange plants red shadows sun trees ue vine vines vineyard vineyards wall window wine winery wine” yellow “long

vinesFlickr Hive Mind Users: moonman82 kadav MondoDondo xgray helveticaneue Mr Perry dawn m. armfield Kelly's Lens Tina McNeill CropShot Dominique Guillochon (more)  Preferences 
 Favorites  Groups  Interestingness  Recent  Tags  Text  User  Advanced 

Welcome to Flickr Hive Mind, almost certainly the best photo search engine on the web. Long time users may need to re-authenticate for FHM to work properly (go to preferences, log out, log in)

 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind. If you log into Flickr you will see your private photos and larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/vines Hits: 113180 Pages: 2264 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
gotta jump (mohini :: mangopowergirl.com) Tags: lake ny newyork vines wine country upstate grapes farms grape seneca riesling specks
Bright sun on the Vineyard (CropShot) Tags: sunset france vineyard vines wine grapes perigord bergerac
Waiting for the Wisteria (Anita K Firth) Tags: park plants flower brick gardens official vines shadows walkway grapes wisteria thornes supports formalgardens
Amanda in Vines (Kelly's Lens) Tags: summer amanda 1 vines
among the vines (Rachel Dunsdon) Tags: mist southafrica vineyard vines grapes capedutch
old cream brick house side (Paper Cat) Tags: old house brick home vines district historic neighborhood
Butlerville School Edit (Jennifer Wiggins) Tags: old school sky brick abandoned clouds vines indiana creepy southern edit ue
a typical sight in napa valley (citizensunshine) Tags: california field vineyard vines wine farm vine fraternity hills winery grapes napavalley napa fields chevron zigzag zetapsi chevrons larkmead
H&G's Rings (Colleen - benandcolleen.us) Tags: wedding white green 35mm canon gold leaf vines diamond rings 5d 14l
22/365 You make beautiful things (everything.glorious) Tags: shirtless selfportrait me self naked nude vines dirt 365 365days 365project
Vines in Fall (MondoDondo) Tags: light red fall leaves yellow vines wine sonoma vineyards
Linear Worlds (Dominique Guillochon) Tags: wood trees light usa sun sunlight tree lines metal fence soleil vines shadows sandiego sunny aftertherain balboapark bois ombres domguillochon cuttreetrunk linearworlds
Number 14 (country_boy_shane) Tags: street city italy plants yellow vintage vines doors arch open flat doorway cover bark entryway portal sorrento canopy dimension locked tone canonef2470mmf28lusm entry doorbell stagnello twisting overtake tonality canon40d shanegorski
Chinese Trampet Vines (bluehazyjunem) Tags: flower vines chinese july trumpet center end 2012 oofuna tamron90
long wait (dawn m. armfield) Tags: bw boston leaf vines decay massachusetts grain monotone d200 freedomtrail gravestones burialground coppshillburyingground sylviaplath
Good Morning Monday! (strawberriebld) Tags: camera trees club digital lost vines nikon space greens d80
dozing (helveticaneue) Tags: autumn brick abandoned yellow vines october pennsylvania decay 2006 shamokin bulldozer centralpa centralpennsylvania kicey laurakicey
Old Gray in Mid Summer (Mr Perry) Tags: vines weathered ruraldecay abandonedfarmhouse ruralexploration rurex pentaxk10d smctakumar13528mm
Cure d'Attalens winter vineyards (overthemoon) Tags: bw landscape schweiz switzerland vines suisse vineyards walls svizzera slopes vaud lavaux romandie chardonne vision:text=0748 vision:outdoor=0982 vision:ocean=0711 curedattalens
Rotterdam City Hall Courtyard (Tsewang K.) Tags: sky green castle netherlands garden vines rotterdam cityhall nederland courtyard palace townhall nl tuin stadhuis binnenplaats klimplant klimplanten
Rainbow Vines (Tina McNeill) Tags: color oklahoma vines 2009 3waychallenge poeticvisionsphotography
View fron the balcony - Hotel Cala Vinas (w126uk / Duncan Joint) Tags: beach hotel spain vines pentax playa mallorca cala majorca vinyes barcello k20d 18250mm justpentax w126uk duncanjoint
Laguardia (Pablo Caas) Tags: ice rain vines laguardia hielo lava cepas strains riojaalavesa sierracantabria capadelnorte
 (themerzak) Tags: trip film leaves wall 35mm vines ivy olympus 100 35 ektar
Rhode Island Redeye (tiger289 (The d'Arcy dog supporters club)) Tags: plants chickens gourds vegetables fruit beans vines chili bees tomatoes orchard honey cabbage eggs peas peppers melon tractors greenhouses hothouse pumkin bittermelon mowers rhodeislandred bokchoy pakchoy beehives pollination pollinators workerbees
Domaine De Grand Pre Winery - Grand Pre, Nova Scotia - Canada (Jason Lorette) Tags: wedding vines wine grand winery pre grapes domain
winter in the vineyard (armykat) Tags: winter blackandwhite bw vineyard vines grapevines frederickcounty linganorewinery linganorewinecellars frederickwinetrail berrywineplantations mountairymaryland
My Favorite Vineyard ... again (Tom Moyer Photography) Tags: california fall vineyard vines sonomacounty winecountry vision:mountain=0612 vision:sunset=0543 vision:sky=0927 vision:car=0744 vision:clouds=0932
Jason's Vineyard's Susan Gabriel Duo jazz on the vine vineyard "long Island Jazz Music (moonman82) Tags: music island vineyard vines wine country vine longisland winery vineyards grapes horticulture grape long vino viticulture tasting jazzmusic wineries grapevines makingwine longislandvineyards wine jasonsvineyards jazzonthevine wines longislandwineries susangabrielduo wineries tastings
Millers Crossing band Harvest Bluegrass Festival at Palmer Vineyards (moonman82) Tags: music island vineyard vines wine country vine longisland winery vineyards grapes horticulture grape long vino viticulture tasting jazzmusic wineries grapevines millerscrossing makingwine longislandvineyards wine jasonsvineyards jazzonthevine wines longislandwineries susangabrielduo harvestbluegrassfestivalatpalmervineyards wineries tastings
Pillar of church Palma (Broo_am (Andy B)) Tags: lighting street door flowers light white plant black apple church leaves statue buildings spain vines shadows close decoration iglesia doorway majorca iphone iphoneography
The Green Room (GaryTumilty) Tags: windows plants glass grass vines bars greenhouse prestonpark stocktonontees
Du Toits Kloof Pass (Bradclin Photography) Tags: family southafrica vines cellar worcester mountainpass westerncape karoonationalpark autumcolours dutoitskloofpass conradie quivertress hexrivermall
Sun Sets at Titus (BobMc) Tags: sunset sun fall leaves set vineyard vines nikon vine titus 70200mm d300
The Van 2 (samson_j_hall) Tags: dark vines fear ghost eerie creepy mysterious van
Doodle 9/11/09 (Daily Doodles) Tags: ocean flowers sea wild cactus orange plants abstract green art floral leaves garden painting stars fun creativity flow petals interesting vines funny colorful meditate chaos random squares drawing abstractart vibrant teal circles surrealism creative shapes shell vivid bubbles doodle loops messy expressionism expressionist swirl surrealist meditation pinwheel create aquatic trippy creature biology rotating scribble linedrawing whimsical bubbling intuition penandink plop splat sloppy chaotic squiggles bigbang artprint abstractexpressionist abstractexpressionism psychedelicart dailydoodle gloppy markerdrawing greenart orangeart doodledrawing
door with vines in the morning light (Love the 214) Tags: door vacation mexico vines 15 sanmigueldeallende favs 75views top20doors
Harvest 2011 - Take 3 (ohad*) Tags: california blue autumn red food green fall nature leaves yellow fruit canon season vineyard vines wine foliage grapes napavalley sthelena ohad 50d ohadonline canon50d canonef24105mmf4 ohadbenyoseph ohadme klettervineyard
recycle bin (xgray) Tags: trip blue plants color green film overgrown analog 35mm austin nc vines alley texas kodak olympus bin 400 portra400nc 40mm recycle recycling 35 portra olympustrip35 trip35 undergrowth kodakportra400nc uploadx kodakprofessionalportra400nc
Pink Lilly Flower Vine Tattoo by Jackie Rabbit (Jackie rabbit Tattoos) Tags: california ca city pink flowers dog bird tattoo nude star virginia 3d cool vines colorful lily heart good infinity awesome great pussy feather vine roanoke va lilly anchor lillies chico shoulder floer jackierabbit eyeofjade
Viansa Window (tom911r7) Tags: california leica fall window leaves vines sonoma shutters winecountry viansa vlux1 tom911r7 thomasbrichta
 (kadav) Tags: trees light boy shadow cute film window face leaves silhouette mystery dark vines doubleexposure michigan profile hipster multipleexposure grainy chinon
My last shot (L*Ali) Tags: light newyork green abandoned airplane buffalo vines decay aviation dirty urbanexploration peelingpaint hdr ue lali urbex curtiswright sigma1770mmmacro nikond7000
Hairy Wall (Herman Tse) Tags: canada tree texture wall vancouver vines britishcolumbia roots climbing e3 airroots airroot
Grape Leaves of Napa (Vincent Anton / aka Astrovine) Tags: autumn napavalley leaves view 2004 lumix trees vineyard vines wine winery calistoga california road grapes
Stucco Wall.jpg (Mario Giambattista) Tags: flowers orange window yellow wall photo vines colorful with framed decoration vine wallart tuscany colourful decor interiordesign homedecor stucco oilpainting homedecoration homedesign workofart colourprint foryourhome mariogiambattista
Halloween Decorations Pirate Skelletons2 (2mnedolz) Tags: dog cats fall halloween gourds skulls scary vines spiders snake trickortreat pirates blueeyes pumpkins scarecrow harvest snail ivy frog creepy spooky gargoyle erie bloody scaryclown nightmarebeforechristmas evilclown halloweenmask halloweendecorations gloweyes deafcat skelletons fallfun outdoordecorations halloweencats halloweenfun catpirate scaryscarecrow scaryscarecrowscarecrowhalloweendecorationsskelletonspiratesspookyeriecreepyhalloweenmaskoutdoordecorationscatshalloweencatsspiderssnailgargoylepumpkinsharvestgourdsvinesevilclownscaryclownfrogdogdeafcatblueeyescatpira
Crocus (Tina  **~) Tags: flowers sun sunlight weather canon march vines warm open sunny sprin
Walk the Line (blue foot) Tags: green nature countryside vines purple earth australia grapes farrow onlyyourbestshots
Spring is coming! (Lindsaymp) Tags: travel flowers cambridge england blackandwhite brick london heritage history vegetables vines university unitedkingdom colleges ancestors cambridgeuniversity

page:  1   2   3 
size:  - 



50 vines 11 grapes 10 vineyard 9 leaves wine 7 green 6 california vine plants flowers fall 5 light brick yellow winery 4 trees vineyards 3 autumn wall creepy sun grapevines film country window 35mm shadows colorful napavalley grape bw canon decay abandoned orange horticulture leaf vegetables dark longislandwineries sky fruit nature wineries” wedding winecountry majorca jazzmusic viticulture color nikon sonoma jasonsvineyards city longislandvineyards wineries nude white music gourds tastings” vino “long decoration old 35 ue newyork red wine” blackandwhite jazzonthevine olympus tree sunset makingwine tasting” longisland street flower wines” open door dog doorway trip southafrica sunlight susangabrielduo spain sunny ivy garden island blue arch klimplant 365days rhodeislandred centralpa london tamron90 multipleexposure shapes palace farms stagnello tom911r7 church playa vancouver airplane lilly abstractart cover winter portra nightmarebeforechristmas silhouette 15 wild pollinators shanegorski psychedelicart rain windows july balboapark walls portal cats peppers deafcat sthelena me selfportrait centralpennsylvania pirates surrealist stadhuis diamond creativity interesting cool indiana sloppy d300 40mm melon virginia naked workerbees tuscany homedesign warm park lighting monotone undergrowth scaryscarecrow cabbage vision:outdoor=0982 recycling stars k20d foryourhome southern family duncanjoint airroots riesling good eerie álava fallfun bloody ohadbenyoseph ancestors hipster vintage ca vinyes bubbles frederickwinetrail gravestones pentaxk10d netherlands cityhall 1 colourful bergerac tattoo outdoordecorations 100 infinity whimsical orangeart flat blueeyes iglesia berrywineplantations orchard kodakprofessionalportra400nc penandink halloweenfun lillies chili ohadonline gardens ruraldecay chaotic photo dirty mountairymaryland circles snail mowers nederland unitedkingdom 50d mysterious flow canada 2012 expressionism 400 prestonpark riojaalavesa sylviaplath trickortreat lumix tractors chevron purple heritage spooky ©poeticvisionsphotography spiders doors curtiswright cactus locked soleil art ghost top20doors harvest food vacation larkmead grainy cambridge urbex canon50d metal onlyyourbestshots viansa dailydoodle halloweenmask climbing ombres halloweencats castle canopy summer decor iphoneography rotating framed mountainpass portra400nc greens pink justpentax plop fear capedutch pinwheel random mexico pentax eyeofjade plant cepas shell meditate floer entryway scary twisting wallart canonef24105mmf4 nikond7000 70200mm canonef2470mmf28lusm 5d leica floral worcester harvestbluegrassfestivalatpalmervineyards peas w126uk e3

Pairs: 5 vines,vineyard grapes,vines leaves,vines 4 vines,wine fall,vines brick,vines 3 fall,leaves grapes,wine california,vines bw,vines green,vines

Users: moonman82 kadav MondoDondo xgray helveticaneue Mr Perry dawn m. armfield Kelly's Lens Tina McNeill CropShot Dominique Guillochon Mario Giambattista blue foot 2mnedolz Tsewang K. tiger289 (The d'Arcy dog supporters club) bluehazyjunem L*Ali samson_j_hall everything.glorious Colleen - benandcolleen.us Lindsaymp ohad* Anita K Firth citizensunshine Tom Moyer Photography Bradclin Photography tom911r7 country_boy_shane armykat Love the 214 Daily Doodles Rachel Dunsdon Broo_am (Andy B) overthemoon Pablo Cañas mohini :: mangopowergirl.com GaryTumilty Tina ღ ☺♥☼*♥*~ Jennifer Wiggins Herman Tse BobMc Jackie rabbit Tattoos strawberriebld Jason Lorette Paper Cat themerzak


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.