621stcrw airbase aircraft airforce airmen airnationalguard airplane airport airshow ang aviation c130 f102a f102adeltadagger f16 f16c fightingfalcon guard lasvegas military militaryaircraft militaryaviation nationalguard nevada newjersey newjerseyairnationalguard nj operationunifiedresponse pacaf photo prattwhitney pw soldiers thunderbirds unitedstates unitedstatesairforce us usa usaf usafe usairforce usarmy usmarinecorps viper 横田基地

usairforce    Flickr Hive Mind (more)  Preferences  I order all my professional prints from Adorama Pix in NYC. I recommend them. I prefer METAL. -Nathan
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Advanced 
 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind. If you log into Flickr you will see your private photos and larger thumbnails. Where do these thumbnails come from? How are the photos licensed?
(n) 2008-8199 ~ 2016-03-25 oh CVT (4) (CVT-wings) Tags: airplane aviation overthetop usairforce planespotting airplanepictures generalaviation airplanephotos boeingc17 globemasteriii aircraftpictures dotspotting aircraftpix cvtwings davelenton 088199 25032016
63938 North American F-100F Super Sabre (SteveDHall) Tags: ohio usa abandoned overgrown airplane airport aircraft aviation military north neglected f100 super aeroplane sabre forgotten american derelict dayton usairforce airfield aerodrome unitedstatesairforce northamerican headcorn supersabre nationalmuseumoftheunitedstatesairforce lashenden frenchairforce f100f 63938 northamericanf100fsupersabre 11ez f100fsupersabre northamericanf100f
Republic F-105B Thunderchief 57-5814 466TFS 419TFW Hill AFB 17Sep83 Peter B Lewis (San Diego Air & Space Museum Archives) Tags: airplane republic aircraft aviation thud usaf usairforce militaryaviation prattwhitney unitedstatesairforce f105 thunderchief republicaviation republicf105bthunderchief f105b j75 f105bthunderchief f105thunderchief republicf105thunderchief republicthunderchief republicf105 prattwhitneyj75 pwj75 j75p3 thethud republicf105b 575814
150616-Z-NI803-108 (New Jersey National Guard) Tags: new usa public usmc photo newjersey acc exercise image military guard nj picture free pic images national photograph nationalguard jersey soldiers marines ang usaf marinecorps royalty domain usairforce usarmy airnationalguard unitedstatesairforce airmen usmarinecorps jointtraining aircombatcommand njng newjerseyairnationalguard newjerseyarmynationalguard warrengrovegunneryrange
150415-Z-NI803-786 (New Jersey National Guard) Tags: new usa public training soldier army photo newjersey exercise image aircraft military guard flight nj picture free pic images helicopter national photograph nationalguard jersey mission soldiers ng ang blackhawk usaf royalty pilot copter domain machinegun pilots usairforce helo usarmy aircrew airnationalguard gunnery unitedstatesairforce uh60 airmen njang crewchief m240b newjerseynationalguard rotarywing armyaviation njng aerialgunnery usnationalguard newjerseyarmynationalguard jointbasemcguiredixlakehurst jbmdl jointbasemdl warrengrovegunneryrange 177thfighterwingdetachment1
United States Air Force Academy Cadet Chapel, Colorado Springs, CO (Xavier de Jaurguiberry) Tags: architecture colorado unitedstates unitedstatesofamerica chapel architect coloradosprings som usafa usaf chapelle usairforce colemilitaire architecte unitedstatesairforce etatsunis militaryacademy walternetsch usairforceacademy unitedstatesairforceacademy unitedstatesairforceacademycadetchapel skidmoreowenmerrill acadmiemilitaire miltaryschool
Convair , F-102, Delta Dagger (San Diego Air & Space Museum Archives) Tags: airplane aircraft aviation deltawing usaf usairforce militaryaviation pw convair prattwhitney unitedstatesairforce f102 ffar deltadagger f102a convairf102adeltadagger j57 convairf102a convairf102 f102deltadagger f102adeltadagger convairf102deltadagger convairdeltadagger pwj57 prattwhitneyj57 j57p25 531793
MHU-12 M Munitions Handling Trailer (robtm2010) Tags: ohio usa museum canon aircraft airplanes trailer usaf dayton usairforce t3i munitions nationalmuseumoftheusairforce mhu12 mhu12mmunitionshandlingtrailer
F-16A Fighting Falcon, U. S. Air Force (78-0065), Utah, Hill Air Force Base (EC Leatherberry) Tags: utah military 1978 usairforce staticdisplay fighteraircraft hillairforcebase f16afightingfalcon generaldyamics
USAF Thunderbirds (BP Gross Photography) Tags: usa minnesota june nikon unitedstates jet airshow f16 airforce usaf mn usairforce mankato 2015 f16fightingfalcon usafthunderbirds nikonphotography minnesotaphotography d7100 exploreminnesota minnesotaphotographer usafairdemonstrationsquadron june2015 nikond7100 mankatoairshow minnesotaairspectacular bpgrossphotography minnesotasightseeing 062815 exploretheusa
F-15C-07 (Jeff Head) Tags: usairforce f15eagle airsuperiority f15cd airdomincance usairforcefighters
DSC_2966 (NAVY_ICHIHO) Tags: military usairforce jasdf yokotaairbase f16c
 (E-Maxx) Tags: airplane jump pentax jumper usaf ricoh chute hercules c130 usairforce parachute parachutist paratrooper fallschirm fallschirmspringer c130j ramsteinairbase k30 c130j30 usafe superhercules 86thairliftwing usairforceseurope 37thas 86thaw 088604
150715-Z-YH452-030 (The 177th Fighter Wing) Tags: f16 bulgaria viper bg usairforce airnationalguard unitedstatesairforce fightingfalcon jerseydevils usafe 177th grafignatievoairbase 177thfighterwing bulgarianairforce newjerseyairnationalguard grafignatievo thracianstar flyingtrainingdeployment thracianstar15
F-16A Fighting Falcon, U. S. Air Force, Texas, Naval Air Station Joint Reserve Base Fort Worth, (former Carswell Air Force Base) (EC Leatherberry) Tags: airplane texas military f16 usairforce fighterjet fighteraircraft f16afightingfalcon carswellairforcebase formercarswellairforcebase fortworthnavalairstationjointreservesbase
US Air Force F-15 "Eagle" 85-0106 Oregon ANG (foto-metkemeier.net) Tags: usairforce f15eagle oregonang leeuwardenairbase operationatlanticresolve natoexercisefrisianflag2015
150109-Z-MW427-297 (U.S. Army Alaska) Tags: hockey alaska anchorage usairforce usarmy alcom pacaf sullivanarena alaskanationalguard jber usarak jointbaseelmendorfrichardson 2015armyvsairforcehockeygame
"Hands Up!" (Leezpics) Tags: fighter usaf fairchild airshows usairforce a10 thunderbolt militaryaircraft nellis aviationnation 12november2006 750301
yokota F-15 03 (m9mii13z) Tags: yokota usairforce f15c
yokota F-15 08 (m9mii13z) Tags: yokota usairforce f15c
IMG_7144_edited-1 (delisijean) Tags: airplanes predator airshows usairforce drones lukeafb unmannedaircraft
140616-F-XT249-210 (Pacific Air Forces) Tags: malaysia penang usairforce robertson mys butterworth combatcamera pacaf 1ctcs copetaufan techsgtjasonrobertson copetaufan14 pubutterworth
140612-F-XT249-078 (Pacific Air Forces) Tags: malaysia penang usairforce robertson mys butterworth combatcamera pacaf 1ctcs copetaufan techsgtjasonrobertson copetaufan14 pubutterworth
My Old "Dog Tags" (Day 62) (earladams15) Tags: military chain usairforce dogtags usmilitary
US Airforce - B752 (yak_40) Tags: usaf usairforce zrh b752 90003 boeing752200 wef2014
440th-28 (FortBraggParaglide) Tags: family nc evacuation aircraft northcarolina spouse soldiers heroes airborne fayetteville paratroopers c130 usairforce fortbragg squadron paraglide flightcrew 440th trainingflight aeromedical c130h airforcereserve specialoperationscommand aeromedicalevacuation xviiiairbornecorps 43rdaeromedicalevacuationsquadron 95thairliftsquadron 440thairliftwing popearmyairfield 36thaeromedicalevacuationsquadron 2ndairliftsquadron areomedicalcrew
131114-Z-IM486-046 (The 177th Fighter Wing) Tags: test airplane newjersey acc aircraft military unitedstatesofamerica nj testing f16 nationalguard atlanticcity airforce ac viper usaf runway firefighters ce usairforce airnationalguard civilengineering eggharbortownship aircombatcommand f16cfightingfalcon 177thfighterwing newjerseyairnationalguard
52-1004 (Ken Meegan) Tags: museum tucson globemaster preserved douglas usaf usairforce 021004 pimaairspacemuseum globemasterii c124 43913 c124c 922008 douglasc124cglobemasterii 521004 douglasc124globemaster douglasglobemasterii 901stmilitaryairliftgroup
Department of the Air Force   (USAF)            Boeing 737       N288DP (Flame1958) Tags: las lasvegas nevada egg nv boeing usaf klas 737 usairforce area51 b737 mccarron unitedstatesairforce boeing737 lasvegasairport 0413 2013 737600 mccarronairport boeing737600 090413 b7376 egandg
98-0135 (Rich Snyder--Jetarazzi Photography) Tags: plane airplane fighter lasvegas aircraft nevada attack jet landing nv airforce bomber usaf usairforce mudhen ln f15 mcdonnelldouglas madhatters strikefighter nellisafb f15e strikeeagle rollout usafe lsv klsv 48thfw 980135 airlinersnetreject usairforcesineurope 492dfs statueoflibertywing redflag133
Boeing B-29 Superfortress N529B "FIFI" (KoryC757) Tags: arizona phoenix gateway boeing bomber fifi caf mesa usairforce b29 superfortress aza iwa commemorativeairforce n529b phxspotters wrightr335023duplexcycloneradials
Power House (ChasedPhotography) Tags: california airplane outdoors airport engine machine olympus b17 sanfranciscobayarea bayarea sfbayarea hayward propeller flyingfortress prop rotary warbird usairforce aluminumovercast b17g e520
A-10 Warthog (dcnelson1898) Tags: desert lasvegas military nevada usairforce nellisairforcebase
Convair , F-102, Delta Dagger (San Diego Air & Space Museum Archives) Tags: airplane aircraft aviation deltawing usaf usairforce militaryaviation pw convair prattwhitney unitedstatesairforce f102 deltadagger f102a convairf102adeltadagger j57 convairf102a convairf102 f102deltadagger f102adeltadagger convairf102deltadagger convairdeltadagger pwj57 prattwhitneyj57 j57p25 553389
2012 JB MDL Open House & Air Show (The 621st Contingency Response Wing) Tags: usa us newjersey f16 unclassified thunderbirds usaf released usairforce publicaffairs usairforcephoto jointbasemcguiredixlakehurst usairforcephotobytechsgtparkergyokeres 2012jbmdlopenhouseairshow
Fairchild A-10 Thunderbolt-8737 (rob-the-org) Tags: noflash cropped fairchild usairforce a10 thunderbolt 180mm f13 iso160 gilabendaz 1400sec barrygoldwaterrange
63-8300/61-0080/63-8296/62-4427/63-8307/62-8278/63-8303/63-8266 (Ken Meegan) Tags: republic usaf usairforce amarc davismonthanafb f105 thunderchief f080 masdc f055 f043 f016 amarg 624427 republicf105thunderchief f077 f073 638278 d275 f084 8101983 638300 610080 638296 638307 638303 638266
120129-F-MQ656-782 (DMA Hawaii Forward Center) Tags: usa hawaii unitedstates hi honolulu usnavy usairforce usarmy alohastadium holzworth uscoastguard usmarinecorps pacaf pacom militarytribute woundedwarriors nflprobowl usarpac defensemediaactivity marforpac mq656 techsgtmichaelrholzworth defensemediaactivityhawaiinewsbureau usarmysilentdrillteam
KRIV US Air Force General Dynamics F-16C Fighting Falcon (401) 86-0256 (djlpbb40) Tags: california march us riverside f16 falcon ang airforce viper usaf arb usairforce griffins morenovalley riv generaldynamics fresnoca fightingfalcon kriv f16c marcharb californiaang 194thfs 194th 860256 marchjointairreservebase
WT2206 plowing (JimM2366) Tags: old winter snow truck airport michigan equipment trucks neige heavy plowing runway rollover oshkosh snowplow usairforce snowplows frink snowremoval plowtruck militarytrucks plowtrucks snowremovalequipment oshkoshtruck oshkoshplows oshkoshsnowplow airportsnowplow oshkoshwt2206 frinkrolloverplow
United States Air Force (USAF) Thunderbirds - Lockheed Martin (General Dynamics) F-16C (Block 52) Fighting Falcon - Thunder Over The Boardwalk 2011 - Atlantic City - August 17, 2011 4 316 RT CRP (TVL1970) Tags: airplane geotagged nikon aircraft aviation f100 f16 atlanticcity thunderbirds viper usaf gd usairforce militaryaviation atlanticcitynj pw thunderbird2 atlanticcitynewjersey prattwhitney thunderbird3 lockheedmartin unitedstatesairforce militaryaircraft generaldynamics gp1 d90 f16fightingfalcon fightingfalcon f16c usafthunderbirds thunderbird6 thunderbird1 thunderbird5 thunderbird4 lockheedmartinf16 unitedstatesairforcethunderbirds atlanticcityairshow generaldynamicsf16 nikond90 lockheedmartinf16fightingfalcon block52 nikkor70300mmvr 70300mmvr thethunderbirds lockmart f16cfightingfalcon generaldynamicsf16c thunderovertheboardwalk generaldynamicsf16fightingfalcon generaldynamicsf16cfightingfalcon lockheedmartinf16c f100pw229 unitedstatesairforceaerialdemonstrationsquadron prattwhitneyf100 nikongp1 lockheedmartinf16cfightingfalcon pwf100 f16cblock52 prattwhitneyf100pw229 unitedstatesairforceaerialdemonstrationteam usafaerialdemonstrationteam thunderovertheboardwalk2011 2011atlanticcityairshow
Spangdahlem Air Base open house - Tag der offenen Tr (Credi) Tags: germany eifel usairforce airbase tagderoffenentr spangdahlem spangdahlemopenhouse2011 luftwaffensttzpunktspangdahlem spangdahlemopenhouse
110530-N-TT977-387 (Chairman of the Joint Chiefs of Staff) Tags: arlington washingtondc us gates military wounded va arlingtonnationalcemetery chairman usnavy obama memorialday armedforces usairforce firstlady mullen usarmy uscoastguard usmarinecorps nationalworldwariimemorial mcneeley thejointstaff
_DSC2459 (Inclusive.) Tags: airforce pilot tanker usairforce kc10 refuelingtanker kc10extender 728thairliftsq
2SCR_Afghanistan_air_drop_mission2_26_Aug2010.jpg (U.S. Army Europe Images) Tags: afghanistan airforce usairforce usarmyeurope airdrop usareur 2ndstrykercavalryregiment 2scr 2ndscr
100129-F-0284L-400 (The 621st Contingency Response Wing) Tags: haiti earthquake refugee relief ht airforce usairforce mobility disasterrelief airmen portauprince 621crw aidsupplies 621stcrw operationunifiedresponse portopening
100116-F-5196D-106 (The 621st Contingency Response Wing) Tags: haiti earthquake media refugee relief ht airforce usairforce mobility disasterrelief airmen portauprince 621crw 621stcrw operationunifiedresponse portopening
74-1682 C-130H US Air Force (eigjb) Tags: airplane team support display aircraft transport airshow thunderbirds lockheed hercules c130 usairforce airbase upperheyford c130h 41682 rafupperheyford 741682
N2805J DC-3C American Flight Museum (eigjb) Tags: aircraft nasa edwardsafb douglas dc3 dakota usairforce c47 airbase edw gooneybird drydenflightresearchcenter dc3c kedw n2805j americanflightmuseum flighttestnation2009 43770en americanflightmuseuminc
Burners Lit (Crash Fistfight) Tags: toronto aircraft cne airshow raptor f22 fighters usaf usairforce cias

page:  1   2   3 
size:  - 

Hivemind: http://flickrhivemind.net/Tags/usairforce Hits: 73089 Pages: 1462



50 usairforce 20 usaf 13 aircraft 12 airplane 10 military unitedstatesairforce 8 airforce 7 f16 usa 6 aviation 5 usarmy 4 airnationalguard militaryaviation prattwhitney viper newjersey pacaf airmen 3 usafe newjerseyairnationalguard f16c lasvegas unitedstates nevada airbase airshow airport usmarinecorps ang nj 横田基地 thunderbirds fightingfalcon us c130 pw soldiers nationalguard fairchild jointbasemcguiredixlakehurst ohio photograph exercise bomber penang national atlanticcity disasterrelief aircombatcommand f102deltadagger nv c130h guard pwj57 california portauprince techsgtjasonrobertson pubutterworth museum f16afightingfalcon usnavy copetaufan14 mys uscoastguard convair photo operationunifiedresponse f102adeltadagger f102a jet newjerseyarmynationalguard nikon thunderchief 621crw warrengrovegunneryrange f100 combatcamera malaysia free haiti 621stcrw earthquake convairdeltadagger convairf102deltadagger royalty convairf102 mobility pilot deltadagger republic militaryaircraft j57p25 generaldynamics butterworth image yokota boeing relief 在日米空軍 177thfighterwing f16cfightingfalcon

Pairs: 5 military,usairforce 3 pacaf,usairforce usairforce,横田基地 airplane,usairforce aircraft,usairforce usaf,usairforce f16,usairforce 2 pacaf,penang earthquake,refugee 1ctcs,mys haiti,operationunifiedresponse

Users: San Diego Air & Space Museum Archives 3 The 621st Contingency Response Wing Pacific Air Forces EC Leatherberry Ken Meegan m9mii13z eigjb The 177th Fighter Wing New Jersey National Guard Flame1958 earladams15 KoryC757 SteveDHall U.S. Army Europe Images rob-the-org Xavier de Jauréguiberry Leezpics ChasedPhotography foto-metkemeier.net dcnelson1898 BP Gross Photography robtm2010 Inclusive. TVL1970 Rich Snyder--Jetarazzi Photography DMA Hawaii Forward Center delisijean NAVY_ICHIHO Crash Fistfight Chairman of the Joint Chiefs of Staff yak_40 U.S. Army Alaska Jeff Head djlpbb40 JimM2366 Credi CVT-wings FortBraggParaglide E-Maxx