a100 a300 a99 alpha alpha200 austriasalzburgo avusturya beauty biancoenero black blackandwhite blue bokeh colors dark dslr flower hdr interesting jazzfoto jazzfotos jazzitsalzburg light macro model nature night park people pink red salzburg salzburgaustria salzburgoáustria sigma sky slt slta77 sony sonya77 sonyalpha sonyslta77 street streetphotography water

sonyalpha Flickr Hive Mind Users: Hindrik S jazzfoto.at Raphael Bobillot Douglas M. Paine DarrenNunis melibeo Greg McMullin framptoP - E.V.I.L. Photographer danichtfür -RobW- patries71 (more)  Preferences  Add to Flipboard
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Year   Advanced 

Welcome to Flickr Hive Mind, almost certainly the best photo search engine on the web. Returning logged in users may need to re-authenticate for FHM to work properly (go to preferences, log out, log in)

Dropbox storage - get 20 GB of Cloud Storage for free.

 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/sonyalpha Hits: 182724 Pages: 3655 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
Mele Kalikimaka (Raphael Bobillot) Tags: santa christmas xmas light sexy dark model takumar sony 28mm noel sofa fantasy alpha raphael smc mele lightroom supertakumar melekalikimaka kalikimaka bobillot sonyalpha yongnuo sonya77 yn560 raphaelbobillot yn560iii
Martin Spitzer: guitar / Beni Schmid: violin (jazzfoto.at) Tags: blackandwhite salzburg blancoynegro austria blackwhite concert live sony jazz sw schwarzweiss jazzclub bianconero biancoenero autriche noirblanc salisburgo 2014 jazzit sterrike salzburgo jazzconcert jazzkonzert livejazz salzburgaustria jazzlive avusturya salzbourg  gypsyjazz jazzkeller ustria konzertfotos austriasalzburg volksheim sonyalpha jazzphotos konzertfoto jazzphoto jazz salzburgoaustria  photos jazzfoto photo jazzfotos wwwjazzfotoat jazzitsalzburg markuslackinger jazzitmusikclubsalzburg jazzclubsalzburg jazzitmusikclub jazzkellersalzburg jazzinsalzburg wwwjazzitat concert salisburgoaustria sonyalpha77 volksheimsalzburg salzbourgautriche hotclubdautriche salzburgoustria austriasalzburgo autrichesalzbourg austriasalisburgo ustriasalzburgo
DSC08461 (montoyasg) Tags: portrait people beauty model singapore cosplay sony sharon babe alpha 2009 japaneseschoolgirl sonyalpha sal2470z
Walking In The Park (framptoP - E.V.I.L. Photographer) Tags: park travel red people japan asia flickr availablelight sony places images getty alpha slt gettyimages a77 gettyimage sonyalpha flickrawards flickraward flowerfloweria iamflickr alphagalleria sonyalphagalleria iamlfickr blinkagain getttyimages vision:outdoor=0793 vision:plant=0569 vision:sky=07
Blue Underground (Kreif60) Tags: street city blue people urban blackandwhite zeiss 35mm underground streetphotography bochum ruhrgebiet sonyalpha mirrorless a7r zeiss35mmf28
Las Migas (jazzfoto.at) Tags: barcelona blackandwhite musician salzburg blancoynegro austria blackwhite sony schwarzweiss worldmusic msica vocals jazzclub bianconero canto flamenco biancoenero autriche musicista chant noirblanc quartett salisburgo sterrike salzburgo livejazz concertphotos liveinconcert salzburgaustria jazzlive avusturya musicienne salzbourg piew  concertphoto jazzkeller ustria konzertfotos austriasalzburg  sonyalpha jazzphotos weltmusik konzertfoto jazzphoto ark flamencoband  frauenquartett jazzfoto lasmigas jazzfotos musiksalon alpha77 wwwjazzfotoat jazzitsalzburg markuslackinger jazzitmusikclubsalzburg jazzclubsalzburg jazzitmusikclub jazzkellersalzburg jazzinsalzburg wwwjazzitat jazzsalzburg jazzitmusiksalon salisburgoaustria sonyalpha77 salzbourgautriche salzburgoustria austriasalzburgo jazzit2014 autrichesalzbourg austriasalisburgo ustriasalzburgo
DSC02236 (orgazmo) Tags: availablelight nightshots guam carlzeiss a55 sonyalpha slta55v sal24f20z distagon2420za 24mmf2zadistagon
DSC02559RPS (Scott Glenn) Tags: lighthouse waves stjoseph lakemichigan railing catwalk greatlake saintjoseph southpier a300 stjoe northpier southbeacon sonyalpha puremichigan
Miniature Dubai Skyscrapers (tarmo888) Tags: sunrise miniature dubai aerialview special unitedarabemirates atthetop faketiltshift dubayy photoimage sooc sonyalpha pictureeffect sony geosetter beenwaiting geotaggedphoto burjkhalifa nex7 sel18200 foto year2013 vision:mountain=0812 vision:outdoor=0686
Kits (e_monk) Tags: wild rabbit bunnies nature animal geotagged mammal newjersey nj stuff creativecommons kits animalia slt mammalia hillsborough rjs cottontail easterncottontail sylvilagusfloridanus chordata eutheria babybunnies ecdysozoa vertebrata gnathostomata tetrapoda amniota lagomorpha leporidae attributionnoncommercialsharealike eukaryota sylvilagus a99 sonyalpha eumetazoa ccbyncsa theria sal35f14g euarchontoglires taxonomy:kingdom=animalia taxonomy:class=mammalia taxonomy:phylum=chordata easterncottontailrabbit taxonomy:subphylum=vertebrata taxonomy:order=lagomorpha taxonomy:family=leporidae taxonomy:genus=sylvilagus taxonomy:subclass=theria taxonomy:infraclass=eutheria yardbunny taxonomy:binomial=sylvilagusfloridanus taxonomy:common=easterncottontail taxonomy:superclass=tetrapoda sfloridanus taxonomy:domain=eukaryota taxonomy:infraphylum=gnathostomata taxonomy:common=rabbit taxonomy:species=sfloridanus taxonomy:superphylum=ecdysozoa taxonomy:subkingdom=eumetazoa taxonomy:microphylum=amniota taxonomy:superorder=euarchontoglires taxonomy:common=easterncottontailrabbit sonyalphaslta99 2013emonk
City of Angels (GabrielaPH Brasil) Tags: city pink blue sunset red brazil bw orange dog brown sun white black flower verde green luz praia beach nature paran colors yellow branco azul brasil silver cores gold amazing purple natureza laranja gray magenta violet rosa preto vermelho dourado amarelo santos lime fotografia gabriela cinza pretoebranco vinho ouro violeta roxo marrom brilho prata limo bcw penha patobranco betocarreroworld sonyalpha coronelvivida a37k gabrielaph
Scarlett's big photoshoot (mshutchison81) Tags: baby calgary kids kid babies sony alberta acting alpha a200 chiropractor bowness strobist sonyalpha calgaryphotographer sonyalphaa200 calgaryweddingphotography blondebabygirl sonystrobist stickoutyourfacephotography sonyhlv58flash elanfamilywellnesscentre alphasrobist stickoutyourface elanfamilywellnesscentrecalgary elanfamilywellness drjosephenejuell elanfamilywellnesscentreicpachriropractorcalgarynsanetwo elanfamilywellnesscentreicpachriropractorcalgarynsanetworkspinalanalysisprenatalchiropractorpregnancyfamily elanfamilywellnesscentreicpachriropractorcalgarynsanetworkspinalanalysisprenatalchiropractorpregnancyfamilydrjosephenejuell
009 (DarrenNunis) Tags: hdr 2875mmf28 a99 sonyalpha guygowan 365year4
Rosetta Stone (-RobW-) Tags: friends red sea people woman person chalk sony pebbles cliffs alpha sevensisters a100 sonyalpha sony1870
Die Grne Zitadelle (tor-falke) Tags: reflection building architecture germany deutschland europa sony magdeburg architektur gebude hundertwasser spiegelungen sonyalpha sachenanhalt alpha200 fotogruppemagdeburg torfalke flickrtorfalke
Josphine (Azraelle29) Tags: dog chien bretagne course plage finistre azraelle sonyalpha sigma150500 sonyslta77 azraelle29
Daisy (Novella Photography) Tags: park pink flowers flower macro texture garden australia perth kingspark westernaustralia paperdaisy sonyalpha vision:sunset=0505 vision:mountain=0611 vision:plant=0663 vision:outdoor=0695 vision:sky=0708
Duo (2) (Hindrik S) Tags: blue sky netherlands loft waddenzee boat ship sony nederland noordzee lucht tamron cpf noordholland a300 waddensea wieringen denoever tamron1750 sonyalpha tamronspaf1750mmf28xrdiiildasphericalif 300 alpha300 sonyphotographing
344 (DarrenNunis) Tags: bokeh hdr 200mmf28 a99 sonyalpha guygowan 365year3
Mercedes Benz SLS AMG Black Series 2013 (f1jherbert) Tags: black mercedes benz track day sony peter international mercedesbenz series motor alpha circuit goodwood sls 65 amg a65 2013 saywell sonyalpha goodwoodmotorcircuit worldcars petersaywell mercedesbenzsls mercedesbenzslsamg goodwoodwestsussex goodwoodchichester sonya65 sonyalpha65 alpha65 goodwoodchichesterwestsussexengland petersaywellgoodwood petersaywellinternationaltrackday mercedesbenzslsamgblackseries2013
Rosa y nieve (melibeo) Tags: planta primavera europa europe sony nieve flor rosa catalonia catalunya catalua lloret lloretdemar flowerlover sonyalpha
La Catedral (Fernando "El Krusty" Meza) Tags: street old blue sky classic church mexico df sigma a100 fernandomeza sonyalpha sigma1850mmf28exdcmacro
on a wheel! (Mario Ottaviani Photography) Tags: show street italy wheel photography photo interestingness interesting flickr artist italia foto photographie minolta sony exploring picture tokina acrobat fotografia alpha bergamo interest f28 interesante talented interessante artista spettacolo entertaining ruota 80200mm atx fotografa tumbler saltimbanco minoltamount acrobata interessant saltimbanqui intressant bergamoalta cittalta mountebank sonyalpha saltimbanque minoltaaf sonya77 slta77 sonyslta77 sonyslta77v slta77v marioalpha marioottaviani
Float of Nebuta Matsuri () (chee_hian) Tags: japan sony aomori lantern float matsuri nebuta   5photosaday nebutamatsuri  sonyalpha alpha100
Bokeh Lights (Raphael Bobillot) Tags: light color colors smile night dark bokeh sony alpha sal vibe a77 obscurity 50f14 sonyalpha sal50f14 slta77
Clownfish (Jon Lenzmeier) Tags: sony clownfish alpha sonyalpha alpha200 sal18250
ART -- DSC02577 (Lance & Cromwell more Calif PICs coming) Tags: nightphotography oregon sony nightshots highway101 portorford trianglesquare onelumportwo pointb sonyalpha currycounty nex6
Paella - Caf Versalles (aligranu) Tags: barcelona travel summer espaa holiday spain streetphotography paella streetfood barcellona 2014 travelphotography sonyalpha sonyalpha350 cafversalles
I'm Sleepin!! What do you want........ (Kerri Afford) Tags: possum cute nature animal sony marsupial animalplanet specanimal sonya100 sonyalpha challengeyouwinner wildlifeofaustralia woamonthlyiconwinner bestofaustraliaaustralia mammalsmarsupialsshowcase
DSC07829 copy (greendot) Tags: roadtrip blythe prima aubrey rbl sonyalpha grimeton sonyalpha100 sonyalphadslra100 primadolly pd2a wapn 070710 greendotblytheslideshow gre33ndotblythess
Aves en el Parque Bicentenario (Seba Silva) Tags: chile park parque santiago white black bird sony bn 300mm ave alpha slt a57 stgo vitacura gorrion bicentenario sonyalpha trile 55300mm sonya57 slta57 sal55300
Converse All Stars (Nic Taylor Photography) Tags: zeiss shoes sony sneakers trainers converse converseallstars carlzeiss weddingphotographer portraitphotographer sonyalpha eventsphotographer variosonnart282470 zeiss2470f28 sonya77 photographermerseyside sonyslta77 photographersthelens portraitphotographersthelens
Ol` yellow eyes is back... (patries71) Tags: owl hedwig uil dierenrijkeuropa sneeuwuil sonyalpha patries71
Multiphasic extreme~IR (Douglas M. Paine) Tags: park longexposure red bw test lens landscape ir interesting sony tripod extreme experiment multicoloured example filter hardcore infrared alpha dslr douglas effect paine r72 a700 sonyalpha alphafish digitalsinglelensreflex multiphasic douglasmpaine dmpaine
pantheon: foucaults pendulum (smartvital) Tags: paris france pantheon pendulum a100 sonyalpha faucault smartvital
Stone washed (smarthair) Tags: camera summer nature water rural river waterfall stones sony ngc falls waterfalls cumbria rivers views alpha dslr a200 derelict picnik h20 distinguished longtown northcumbria nbw natureitsbest waterform sonyalpha natureplus beautyofwater naturewatcher sonyalphadslra200 distinguishedlongexposures smarthair kirklintonhall
Kunshan at night HDR (Douglas M. Paine) Tags: china bridge reflection water stone night buildings river landscape rocks crossing sony low perspective m level alpha dslr douglas current hdr kunshan jiangsu paine a700 sonyalpha nighthdr dpaine alphafish hdratnight digitalsinglelensreflex douglasmpaine dmpaine
Manana Island, Oahu, Hawaii (joe_aikkaravelil) Tags: hawaii sony sonyalpha joeyahoo cruiselikeanorwegian sel2470z sonya7s ilce7s joeaikkaravelil
Escaping from darkness (Hindrik S) Tags: light lamp train sony rail railway spurt cpf friesland trein leeuwarden spoorwegen sneek arriva a300 frysln liwwadden ljouwert stadler snits sonyalpha sneeknoord 300 alpha300 sonyphotographing
XXIII Internazionali Femminili di Tennis 2010 - Julia Grges (GER) (ObiOne 54) Tags: tennis sicily countryclub palermo sicilia wta jol sonyalpha obione womantennis countrytimeclub tennisfemminile palermophotoworld xxiiiinternazionalifemminiliditennis xxiiiinternazionalifemminiliditennis2010
500 milimetros 1 (Daro H. Ruiz Fotografa) Tags: colombia sonyalpha sonya200 alpha200 alphadslra200 httpdariocobomifotoblogcom dhrcobogmailcom darohernnruizc httpwwwwixcomdhrcobodhrcobo
010 (imagepoetry) Tags: pink plant flower detail macro nature beauty yellow garden season purple blossom sigma dry 70mm a65 imagepoetry sonyalpha
Kaiserdamm, Berlin-Westend (danichtfr) Tags: berlin 35mm sony f18 nex guessedberlin sonyalpha gwbgpeole berlinwestend sonynex6 sonye35mmf18oss dundkauftour blockrunde
Electricidad desbocada (kico250) Tags: longexposure light sky naturaleza luz nature water night noche agua badajoz cielo nubes reflejo tormenta nocturna laguna rayo temporal dios embalse trueno extremadura franciscodecordoba charca relampago largaexposicion dioses villanuevadelaserena sonyalpha pico250 lacoronada kico250
Marble Trees (Naufragus_Simia) Tags: tree sony fisheye marble a390 sonyalpha
The Sheffield Eye. (Greg McMullin) Tags: minolta walk sheffield saturday bigwheel f28 hdr 22mm adobelightroom photmatix sonyalpha sheffieldeye
Still or sparkling? (Joseph R) Tags: glass reflections catchycolors lowlight colorful bokeh sparkling iso1600 highiso sonyalpha sal18250 sony18250
Columbine Haze (Angela M. Miller (on a long, long break)) Tags: flores flower macro fleur blurry blumen a33 aquilegia columbine fiori ranunculaceae slt tamron90mm columba grannysbonnet sonyalpha perennialplant sonya33 sonyslt
puddle jumper (getthebubbles) Tags: blue selfportrait me rain jump diptych lori sp waterdrops wellies day82 getthebubbles 365days sonyalpha rainingfinally
El Pensador (melibeo) Tags: sculpture art statue arte sony thinker escultura negative estatua negativo rodin pensador sonyalpha

page:          1        2        3 
size:     -      



50 sonyalpha 27 sony 13 alpha 6 nature 5 blue 4 light park people slt red flower hdr 3 sky bokeh a100 sonya77 a300 pink sonyslta77 night blackandwhite water black macro street dslr a99 alpha200 austriasalzburgo salzburgoáustria avusturya biancoenero salzburgaustria slta77 model dark interesting beauty europa availablelight austriasalzburg alphafish luz jazzitmusikclubsalzburg f28 nightshots konzertfoto salzbourg sal18250 a700 áustriasalzburgo 2014 bianconero animal a200 river jazzkeller barcelona α300 purple livejazz noirblanc paine summer digitalsinglelensreflex sonyphotographing city jazzkellersalzburg jazzlive yellow reflection wwwjazzitat white 萨尔斯堡 salzburgo flickr zeiss jazzclubsalzburg jazzitmusikclub jazzclub jazzphotos jazzfoto jazzfotos jazzitsalzburg streetphotography sigma colors salzburg salisburgoaustria salisburgo 35mm carlzeiss a77 cpf guygowan salzbourgautriche blancoynegro jazzphoto österrike minolta landscape jazzinsalzburg alpha300 blackwhite австрия douglasmpaine a65 japan dog rosa longexposure austriasalisburgo austria bw sonyalpha77 autrichesalzbourg konzertfotos autriche douglas travel dmpaine schwarzweiss garden fotografia wwwjazzfotoat áustria markuslackinger sp puremichigan thinker vermelho baby пение 55300mm 365days agua distinguished photographermerseyside fotogruppemagdeburg marble sonyalpha350 sonyalphadslra200 canto weddingphotographer orange a37k hedwig gray natureplus asia petersaywellinternationaltrackday atthetop tamron1750 easterncottontail stjoe arriva clownfish photos“ church bergamo easterncottontailrabbit ruota geotaggedphoto joeaikkaravelil dioses float goodwoodchichester geosetter alphadslra200 variosonnart282470 pd2a yongnuo vertebrata raphaelbobillot azul cores wild elanfamilywellnesscentreicpachriropractorcalgarynsanetworkspinalanalysisprenatalchiropractorpregnancyfamily sonyalphaa200 rain waddenzee experiment mammalia azraelle sofa multicoloured sal55300 unitedarabemirates waterfalls photoimage blondebabygirl nocturna urban benz taxonomy:common=rabbit womantennis me sonyalphaslta99 selfportrait blossom brilho sneek ngc magdeburg ir fiori entertaining gabrielaph chien spiegelungen śpiew nex6 amg taxonomy:infraclass=eutheria dubai blumen rivers travelphotography negativo marrom diptych sonystrobist praia lasmigas chant dry patries71 lowlight sonyalpha65 day82 sel2470z escultura miniature babe xmas nbw lakemichigan smc snits kits vision:sky=07 walk trueno httpdariocobomifotoblogcom a57 gwbgpeole pointb japaneseschoolgirl cafèversalles yn560iii raphael ねぶた祭り brazil series elanfamilywellnesscentre blurry blockrunde spettacolo daríohernánruizc gebäude melekalikimaka places taxonomy:common=easterncottontailrabbit peter tamron90mm alpha100 silver sylvilagus italia china taxonomy:superorder=euarchontoglires test yardbunny alpha77 penha villanuevadelaserena sw pantheon netherlands sony1870 sonyalphadslra100 mercedesbenz zeiss35mmf28 supertakumar jazzit2014 attributionnoncommercialsharealike show torfalke deutschland lucht jazzitmusiksalon elanfamilywellnesscentreicpachriropractorcalgarynsanetworkspinalanalysisprenatalchiropractorpregnancyfamilydrjosephenejuell challengeyouwinner converse santiago wheel sneakers goodwoodchichesterwestsussexengland naturaleza taxonomy:phylum=chordata liwwadden laranja bobillot columba palermo primadolly jazz“ gettyimage

Pairs: 9 sony,sonyalpha 3 blue,sonyalpha hdr,sonyalpha people,sonyalpha 2 a99,hdr bokeh,sonyalpha pink,sonyalpha macro,pink garden,pink alpha,people guygowan,sonyalpha

Users: Hindrik S jazzfoto.at Raphael Bobillot Douglas M. Paine DarrenNunis melibeo Greg McMullin framptoP - E.V.I.L. Photographer danichtfür -RobW- patries71 Scott Glenn chee_hian Kreif60 kico250 greendot joe_aikkaravelil aligranu tarmo888 Angela M. Miller (on a long, long break) GabrielaPH Brasil Azraelle29 tor-falke Nic Taylor Photography smartvital Seba Silva e_monk f1jherbert Mario Ottaviani Photography smarthair getthebubbles orgazmo Jon Lenzmeier mshutchison81 montoyasg Fernando "El Krusty" Meza ObiOne 54 Novella Photography Lance & Cromwell more Calif PICs coming Naufragus_Simia Darío H. Ruiz Fotografía imagepoetry Joseph R Kerri Afford


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.