2013 anthony antonio austin capital christian edward eight graffiti labanex landoftherisingsunflowersshizshizuokakobeosakashibuyayokahamaramenmuseumfoodfishsushipeopleasianfacesfacewalktempleshrinepeopledancingteaonsentravelrestaurantseatisetanairport london lowry marcos media metro metrorail microsoft music nippon park people performing podcast rail s12 s13 s2013 san shibuya shiz shizus shot street sun tebchrani texas twiz twizshiz tx us vlog walking webisode windows

shiz    Flickr Hive Mind (more)  Preferences  Ah, a new business internet connection and router in CA, FHM is now about as snappy as it ever was! Enjoy! -Nathan
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Advanced 
 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind. If you log into Flickr you will see your private photos and larger thumbnails. Where do these thumbnails come from? How are the photos licensed?
FreshPaint12_8_2013 4_20_51 AM_jpg (Antonio TwizShiz Edward) Tags: podcast us san texas tx performing arts vlog edward anthony sanmarcos antonio marcos hermes lowry s10 association shiz s11 s12 s13 s08 webisode labanex s09 s2013 shizus twizshiz sanmarcossummer s201308 s201309 s201310 s201311 s201312 vtlicne
IMG_20120716_125247 (Antonio TwizShiz Edward) Tags: labanex antonio edward anthony lowry railroad rail road trains train tmis the moving infrastructure tmis01 tmis010004 20120719 0004 01 capmetro capital metro station light lightrail commuter metrorail howard wells branch texas 20120716 vlog mini shiz style office mscmrso microsoft 365 2013 15 archive archived videos video youtube flickr i35 austin shizus twizshiz twiz tx parkway pkwy
IMG_20130611_183856 (Antonio TwizShiz Edward) Tags: road podcast austin bug us san texas tour tx vlog move edward anthony sanmarcos antonio marcos lowry rd roadrunner shiz s06 stink s13 twiz 2013 webisode labanex s2013 shizus twizshiz 20130609 20130606 20130605 20130607 20130603 20130604 20130608 20130602 20130612 20130610 20130613 20130614 20130615 20130611 s201306 smtmtsb
VID_20130711_201230 (Antonio TwizShiz Edward) Tags: park plaza summer music concert san track texas outdoor live tx performing arts band edward mind soul anthony antonio marcos lowry association shiz summerinthepark twiz labanex soultrackmind shizus twizshiz 20130711 smpaa20130711
Christmas wall (Bee Lavoe Emay Esdee) Tags: street urban london art st dark ma skull graffiti artist tank cows action stockholm secret military helmet tags spot lakeside east urbanart story pedro morbid hero freehand walls graff themed sketches rom ilford roe legal mds walthamstow leake shiz mone dpc mutilation handstyles artfag legalwalls plaistow sey romford respirator gland seyer sekiu omt legalgraffiti shoom twerk faver madcaps leakestreet evolab 3hand leakest militaryaction dyelk shizartist pedronicus blavoe mrshiz glandal aliensuk
Boswell  & Shiz in Paris (Urbanhearts) Tags: paris shiz boswell urbanhearts streetartwithoutborders
VID_20121031_065400 (Antonio TwizShiz Edward) Tags: windows podcast halloween birds austin during spider us texas phone attack vlog 8 edward anthony homestead extended antonio eight lowry thunder stay shiz webisode labanex 20121101 windowsphone8 shizus 20121102 twizshiz 20121103 20121029 20121031 20121028 20121030 baatdhs shiz20121028 vlog201210218 vlog20121028
Getting jiggy wid it ('gnasher') Tags: irobot shiz gnasher brisk willsmith leakestreet 303db
Mr Shiz - Speaker and Hoody Head (cocabeenslinky) Tags: park street city uk england urban streetart art canon bristol graffiti artist gallery grafitti power shot mr photos graf united kingdom powershot weapon choice graff hs shiz artiste bs1 8b 5hr of sx220 cocabeenslinky
MERRY CHRISTMAS (MMP - Enigma) Tags: streetart london graffiti southbank merrychristmas shiz mrshiz
IMG_20121026_190954 (Antonio TwizShiz Edward) Tags: windows podcast apple america walking hotel us ipod walk south touch vlog arboretum screen surface hwy edward research dell microsoft anthony much homestead extended antonio eight lowry suites stay shiz lenovo burnet burnett iphone 183 webisode iphone5 labanex windows8 20121023 shizus 20121021 twizshiz 20121022 20121024 20121025 20121026 20121027 esamsmw shiz20121021 vlog20121021
VID_20120724_144637 (Antonio TwizShiz Edward) Tags: street leave water station st austin for three grande us office downtown texas shot metro shots howard no tx room capital cream rail edward starbucks agency microsoft anthony splenda 365 antonio interview job issue issues lowry dynamics peppermint 6th metrorail shiz sharepoint crm americano staffing labanex capmetrorail office365 shizus twizshiz 20120724 shiz20120724 gdwigtd gdwigdc
December Digifree (JShine) Tags: trip music eye ford station digital stars wagon lights star mirror eyes freestyle shine free spit grand right grill sparkle safari drip note poop mk2 pontiac genius 1970 horn left 1972 scar snot tripto shiz plop toot 1600e cotina
VID_20120724_143949 (Antonio TwizShiz Edward) Tags: street leave water station st austin for three grande us office downtown texas shot metro shots howard no tx room capital cream rail edward starbucks agency microsoft anthony splenda 365 antonio interview job issue issues lowry dynamics peppermint 6th metrorail shiz sharepoint crm americano staffing labanex capmetrorail office365 shizus twizshiz 20120724 shiz20120724 gdwigtd gdwigdc
image (Lola sixx) Tags: random shiz
IMG_20130305_181056 (Antonio TwizShiz Edward) Tags: life podcast us little vlog newyear edward vlogging anthony antonio lowry shiz 2012 reborn s12 s13 2013 s2012 webisode labanex rebourn s2013 20121230 shizus twizshiz s201212 20130316 s201301 s201302 s201303 myrnylv
Shibuya, Japan (21) (weaponofchoice) Tags: park people music sun festival hair walking asian rising tokyo shinjuku long dancing shibuya elvis exotic kobe harajuku land nippon osaka yoyogi bouncer shizuoka nihon shiz yokahama orientals orients japantripapril09 landoftherisingsunflowersshizshizuokakobeosakashibuyayokahamaramenmuseumfoodfishsushipeopleasianfacesfacewalktempleshrinepeopledancingteaonsentravelrestaurantseatisetanairport
shiz-20120828 (Antonio TwizShiz Edward) Tags: road windows podcast modern logo nose us store metro ui interface vlog 8 edward trail user microsoft anthony service antonio whew eight lowry itch shiz fail microsoftstore webisode labanex windows8 20120828 shizus twizshiz shiz20120828 vlog20120828 srftwms
Haifa Streets (41) (Chasing Ghosts LDN / MELB) Tags: streetart photography israel screen warehouse printing ghosttown ghosts haifa shiz chasing keos chased gingie chasingghosts brokenfingaz chasinghosts haifagraff haifagraffiti thewarehousehaifa
Slide08 (Antonio TwizShiz Edward) Tags: office media shot double edward generator short microsoft anthony 365 url antonio productions lowry powerpoint inc shiz partners ynot ymp seae labanex ynottv sereant
Tokyo,  Japan- Harajuku District, Yoyogi Park, Shinjuku District 075 (weaponofchoice) Tags: park people music sun festival hair walking asian rising tokyo shinjuku long dancing shibuya elvis exotic kobe harajuku land nippon osaka yoyogi bouncer shizuoka nihon shiz yokahama orientals orients tokyojapanharajukudistrictyoyogiparkshinjukudistrict landoftherisingsunflowersshizshizuokakobeosakashibuyayokahamaramenmuseumfoodfishsushipeopleasianfacesfacewalktempleshrinepeopledancingteaonsentravelrestaurantseatisetanairport
IMG_20121219_164359 (Antonio TwizShiz Edward) Tags: austin texas tx edward anthony antonio lowry shiz labanex shizus twizshiz
BW-logo-0144-titled (Antonio TwizShiz Edward) Tags: media shot web double edward anthony series antonio lowry shiz doubleshot dshot labanex doubleshotbiz twizshiz {vision}:{text}=0503 {vision}:{outdoor}=0957 {vision}:{sky}=0779 {vision}:{dark}=0828
MONE (JOHN19701970) Tags: street uk england streetart london art wall graffiti artwork mural paint artist may tunnel spray waterloo spraypaint graff aerosol shiz mone 2010 leakestreet
VID_20120828_175349 (Antonio TwizShiz Edward) Tags: road windows podcast modern logo nose us store metro ui interface vlog 8 edward trail user microsoft anthony service antonio whew eight lowry itch shiz fail microsoftstore webisode labanex windows8 20120828 shizus twizshiz shiz20120828 vlog20120828 srftwms
shizmedia-365-cr-1792-1192 (Antonio TwizShiz Edward) Tags: podcast us san media texas tx performing arts vlog edward anthony sanmarcos antonio marcos hermes lowry inc incorporated s10 association shiz s11 s12 s13 s08 webisode labanex s09 s2013 shizus twizshiz sanmarcossummer s201308 shizmedia s201309 s201310 s201311 s201312 vtlicne
VID_20130522_145431 (Antonio TwizShiz Edward) Tags: podcast austin butterfly us texas power tx vlog move edward ag anthony antonio director s05 lowry shiz tryouts s06 s13 cyberlink twiz 2013 webisode alphagraphics labanex powerdirector s2013 shizus twizshiz 20130522 s201305 20130520 20130521 20130523 20130519 20130524 20130601 20130526 20130525 20130530 20130527 20130528 20130529 20130531 s201306 pdtagmb
hk. ubiquitous 1 (deb kan't spell.) Tags: hongkong taxi transport olympus touristy shiz e420
VID_20120710_175142 (Antonio TwizShiz Edward) Tags: storm hot dogs weather austin texas with tx vlog edward anthony tween antonio lowry forecast shiz psychology psychologist labanex shizus 20120710 twizshiz shiz20120710 wfpthds
IMG_20130102_175321 (Antonio TwizShiz Edward) Tags: life podcast us little vlog newyear edward vlogging anthony antonio lowry shiz 2012 reborn s12 s13 2013 s2012 webisode labanex rebourn s2013 20121230 shizus twizshiz s201212 20130316 s201301 s201302 s201303 myrnylv
20140725_202934 (4) (world.through.tablet) Tags: choir hall nokia san texas state 1st daniel tx central performing arts rick first recital center medical edward retreat serenity danny bowen anthony annual antonio marcos ensemble lowry alumni 520 anthem shiz choral alyanna 2014 burge 521 lumia twiz ctmc labanex twizshiz 20140725
Leake Street. (maggie jones.) Tags: london graffiti tunnel waterloo shiz leakestreet
shiz-20130414-6 (Antonio TwizShiz Edward) Tags: podcast apple up grass cat austin us kitten all texas looking tx vlog things edward anthony much antonio promise lowry shiz asmallorange s13 2013 webisode alphagraphics labanex s2013 shizus twizshiz 20130414 20130418 20130415 20130417 20130416 20130419 20130420 s201304 atalump molopro edistdistribution
IMG_20120603_050112 (Antonio TwizShiz Edward) Tags: eye me up logo punto us cool hit media edward anthony coming antonio productions lowry soon theeye shiz ynot ymp labanex ympnet ynottv sereant shizus
Yokohama, Japan-Ramen Museum (87) (weaponofchoice) Tags: park people music sun festival hair walking asian rising tokyo shinjuku long dancing shibuya elvis exotic kobe harajuku land nippon osaka yoyogi bouncer shizuoka nihon shiz yokahama orientals orients japantripapril09 landoftherisingsunflowersshizshizuokakobeosakashibuyayokahamaramenmuseumfoodfishsushipeopleasianfacesfacewalktempleshrinepeopledancingteaonsentravelrestaurantseatisetanairport
WP_20140929_051 (Antonio TwizShiz Edward) Tags: christian edward anthony jules antonio lowry shiz elie labanex twizshiz tebchrani
WP_20140926_13_00_33_Pro (Antonio TwizShiz Edward) Tags: christian edward anthony jules antonio lowry shiz elie labanex twizshiz tebchrani
WP_20140927_12_13_24_Pro (Antonio TwizShiz Edward) Tags: christian edward anthony jules antonio lowry shiz elie labanex twizshiz tebchrani
WP_20140929_056 (Antonio TwizShiz Edward) Tags: christian edward anthony jules antonio lowry shiz elie labanex twizshiz tebchrani
Yokohama, Japan-Ramen Museum (64) (weaponofchoice) Tags: park people music sun festival hair walking asian rising tokyo shinjuku long dancing shibuya elvis exotic kobe harajuku land nippon osaka yoyogi bouncer shizuoka nihon shiz yokahama orientals orients japantripapril09 landoftherisingsunflowersshizshizuokakobeosakashibuyayokahamaramenmuseumfoodfishsushipeopleasianfacesfacewalktempleshrinepeopledancingteaonsentravelrestaurantseatisetanairport
VID_20120730_181436 (Antonio TwizShiz Edward) Tags: desktop windows cheese bar us code phone tag nine bad edward microsoft ms anthony antonio 2d eight lowry qr shiz qrcode codes wp8 barcodes scanlife qrcodes wp7 labanex windows8 microsofttag shizus twizshiz 20120730 shiz20120730 msbcmwe bcmwe
VID_20120910_060329 (Antonio TwizShiz Edward) Tags: moon podcast bus train austin us texas metro tx capital vlog rail mini crescent edward shuttle ms anthony antonio lowry metrorail shiz capitalmetro capmetro webisode labanex shizus twizshiz minishiz 20120910 shiz20120910 vlog20120910 mscmbts cmbts
shiz-20121007 (Antonio TwizShiz Edward) Tags: vegas podcast tom austin studio one us video oak media texas walk tx sony contest pad vlog edward software anthony week series antonio platinum lowry nch videos shiz albin webisode labanex videopad 20121013 20121009 shizus twizshiz 20121007 20121012 20121010 20121011 20121008 nchsoftware shiz20121007 vlog20121007 ctsmsss cunvpss
Getaway driver (LarryLL) Tags: driving tzu shiz
IMG_20121219_164525 (Antonio TwizShiz Edward) Tags: austin texas tx edward anthony antonio lowry shiz labanex shizus twizshiz
eleven11 alleyway (JShine) Tags: walter alley shine spaceinvader stump laugh genius visual society seen deed shiz backdoor juanito narcotics robotswillkill buffmonster urbanmedium enzyme visualnarcotics benwilson mecro catv fminus zoltron moniker eleven11 pasteeater wekillyou gurbur theneighbor knowbody numstein kapitalk eleven11show kegrone michaelslack boisenavalbase
IMG_20121012_192328 (Antonio TwizShiz Edward) Tags: vegas podcast tom austin studio one us video oak media texas walk tx sony contest pad vlog edward software anthony week series antonio platinum lowry nch videos shiz albin webisode labanex videopad 20121013 20121009 shizus twizshiz 20121007 20121012 20121010 20121011 20121008 nchsoftware shiz20121007 vlog20121007 ctsmsss cunvpss
VID_20120910_175231 (Antonio TwizShiz Edward) Tags: moon podcast bus train austin us texas metro tx capital vlog rail mini crescent edward shuttle ms anthony commuter antonio lowry metrorail shiz capitalmetro capmetro webisode labanex shizus twizshiz minishiz 20120910 shiz20120910 vlog20120910 mscmbts cmbts
I want a peach too (dklimke) Tags: wedding basket ivy shiz manzanita assembly
Saint Panels Day (JShine) Tags: uk green mono la quiet shine panel 5 cent lord pi e collab pistol krystal birch stpatrick nano rwk collaboration ka sabotage shiz samwise freeart faf nack 5cents uwp ticky delme bkb czr7 get2 billikidbrand exiter leprashiz ddnyc discoshit riotdebs kaoleum

page:  1   2   3 
size:  - 

Hivemind: http://flickrhivemind.net/Tags/shiz Hits: 5341 Pages: 107



50 shiz 31 labanex lowry antonio edward anthony 29 twizshiz 24 shizus 19 us 18 texas 17 vlog tx 15 webisode podcast 14 austin 8 microsoft 7 metro s2013 s13 6 park 2013 music media 5 windows san shot metrorail twiz graffiti street capital marcos eight walking rail 4 nippon london dancing land festival people harajuku elvis arts bouncer kobe landoftherisingsunflowersshizshizuokakobeosakashibuyayokahamaramenmuseumfoodfishsushipeopleasianfacesfacewalktempleshrinepeopledancingteaonsentravelrestaurantseatisetanairport sun station windows8 orients orientals elie long asian shibuya exotic tebchrani performing osaka shinjuku leakestreet shizuoka rising christian s12 yokahama jules office yoyogi hair nihon 365 tokyo streetart road 3 shine 8 video walk series artist sanmarcos association art logo graff videos capmetro st ms howard japantripapril09 train uk mini gdwigtd issue life s10 hermes

Pairs: 6 labanex,shiz lowry,shiz antonio,twizshiz antonio,edward shiz,twizshiz anthony,antonio edward,shiz antonio,shiz antonio,labanex edward,lowry labanex,twizshiz

Users: Antonio TwizShiz Edward 30 weaponofchoice 4 JShine 3 maggie jones. Lola sixx LarryLL world.through.tablet MMP - Enigma dklimke Bee Lavoe Emay Esdee deb kan't spell. cocabeenslinky JOHN19701970 Urbanhearts 'gnasher'