architecture asia beach blue cebu cebucity cleevillasor clouds creativedigitalphotography feisty ilocos ilocosregion lake landscape luzon luzonisland male mystical nature negros night nikond40x ocean palawan philippineislands philippines philippinetourism photography photoshop pilipinas sand sea shadows shore silhouette sky southeastasia teampilipinas tourism travel travelphotography volcano water waterfront wowphilippines

philippinetourism Flickr Hive Mind Users: Storm Crypt ibarra_svd C L E E ٩(̾●̮̮̃̾•̃̾)۶ ™ jobarracuda SweetCaroline♥ JoLiz ontheraks (slow and getting slower waaa) Kuya D TON70 PaparazSea ♑ docjabagat (more)  Preferences 
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Advanced 

I am a fan of Nicole Atkins's Music. Check her out!

-Nathan

 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/philippinetourism Hits: 1161 Pages: 24 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
Kayangan Lake (Tomasito.!) Tags: ocean chile wood travel blue sea summer panorama lake fish seascape green tourism beach water photoshop macintosh landscape yahoo google interesting nikon rocks asia southeastasia flickr paradise stitch crystal philippines wideangle tourist panoramic leopard walkway mostinteresting stitching traveling picturesque magical coron enchanted bluelagoon touristspot pilipinas clearwater elnido palawan cs4 tomasito ultrawideangle d90 worldwonders beautifulplace philippinetourism macbookpro puertoprinsesa placestovisit mostbeautifulbeach kayangan 18105mm kayanganlake nikond90 vertorama vacationsite nikond90kitlens mygearandmepremium mygearandmesilver mygearandmegold helpchile idealvacationplacephilippines bestpalawansites bestasiantouristspot bestsummervacationplace philippinesummerspots
Into South China Sea (Storm Crypt) Tags: travel sea tourism nature water rain river photography rocks waterfront natural earth stones stpaul cave geology stalactites stalagmites southchinasea formations digitalphotography puertoprincesa palawan ecotourism undergroundriver seawater travelphotography brackish ecosystems philippinetourism naturalwondersoftheworld stpaulundergroundriver subterraneanriver westernpalawan 7naturalwondersoftheworld naturalwondersoftheworldcandidate pcp2011
Mt. Pinatubo Caldera (Storm Crypt) Tags: travel sky mountain lake tourism water rock metal clouds forest landscape volcano lava rocks asia southeastasia waterfront earth crater caldera vegetation ash craterlake vulcan mountainside volcanoes geology volcanic geothermal eruption mtpinatubo philipines luzon freshwater pampanga seismic tarlac volcanology zambales ringoffire deformation stratovolcano aerosols travelphotography activevolcano dacite geologists sulfuric so2 aeta philippinetourism wowphilippines planetarygeology tephra vulcanology seismographs mywinners philippineislands soilmechanics centralluzon ancestralland luzonisland adesite rockdeposits westpacificrim fieldofgeology
Glittering Islands (Storm Crypt) Tags: ocean travel sea tourism beach nature coral islands coast sand marine asia southeastasia philippines shell diving aerial resort shore naturereserve limestone destination coastline reef uninhabited aerialphotography southchinasea marinelife palawan sanvicente smallislands philippinetourism wowphilippines divesite divingsite beachresorts asiancountry palawancoast westernpalawan southchincasea sanvicentepalawan
Leaving Vigan (Storm Crypt) Tags: travel architecture philippines worldheritagesite vigan ilocos oldhouses luzon ilocossur crisologostreet cobblestonestreet northernluzon philippinetourism wowphilippines flickrchallengewinner spanishcolonialhouses ilocosregion
By The Sea (SweetCaroline) Tags: olympus zuiko sweetcaroline coconuttrees samalisland beachresort falala crystalclearwater bythesea philippinetourism wowphilippines puntadelsol pinoykodakero davaodelnorte philippinebeaches davaoregion garbongbisaya
Philippine Eagle (SweetCaroline) Tags: pk sweetcaroline malagos falala davaocity philippinetourism sooc philippineeaglecenter calinan garbongbisaya
The End of the Tunnel (Storm Crypt) Tags: lighting light tourism lamp rock stone rural trekking underground waiting rocks asia southeastasia crystals stones politics philippines columns illumination tunnel calcium gas explore caves gaslamp revolution minerals cave lampara exploration archeology bicol province asean fuel stalactites stalagmites formations pilipinas spelunking crevice lighted ligh albay deposits lumens bicolandia philippinepolitics philippinetourism wowphilippines hoyophoyopan bikol caveopening kweba caveexploration philippineislands camaligalbay hoyophoyopancave bicolregion provinceofalbay anglampara trekkingalbay endofthecave aseancountry
Cebu, Philippines (Post-Apocalypse, the Alternate World) (C L E E () ) Tags: bridge architecture philippines landmarks textures cebu cebucity mactan lapulapu mandaue touristspots travelphotography goldenglobe philippinetourism mactanchannel creativephoto creativedigitalphotography teampilipinas marcelohfernanbridge cleevillasor cebuphotographyclub cebulandmarks
Bantay Church Belltower (Storm Crypt) Tags: travel sky heritage history church museum architecture buildings photography ruins catholic bricks philippines hill structures landmarks bluesky scene belltower catholicchurch ilocos relics redbricks bantay fpj civilengineering travelphotography ilocossur bellfry bantaychurch northernluzon manmadestructures philippinetourism wowphilippines touristdestination northluzon philippineislands ilocosregion luzonisland oldspanishbuildings spanishstructures
Cape Bojeador Light House (Storm Crypt) Tags: sunlight lighthouse building tower heritage architecture gallery antique bricks philippines hill 19thcentury shoreline shore lamps guide nautical ilocos ventilator shipping tours beacon burgos navigation southchinasea luzon lenses lateafternoon optics galleons rockyshores spanishdesign lightstation triangulation ilocandia ilocosnorte manmadestructure octagonal capebojeador harborlight heritagesite lanternroom philippinetourism wowphilippines astragal navigationalaid electricbulbs philippineislands coastallighthouse antiquebuildings burgoslighthouse philippineheritage heritagestructure maharlikahighway ilocosregion luzonisland farocabocapebojeador burgospoint watchroom serviceroom oldspanishbuildings oldspanishlighthouses spanishgalleons northwestluzon nauticalengineering shippingroutes octagonalstonetower fuelhouse colonialdesign spanishstructures spanichcolony lighthouseonahill elevatedlighthouses ilocosnortelighthouses philippinelighhouses
Daybreak (Storm Crypt) Tags: travel sky heritage history tourism silhouette stone museum sunrise buildings shadows cross antique horizon bricks philippines cement structures landmarks oldbuildings landmark belltower restored catholicchurch restoration sinking chuch laoag horizons civilengineering ilocandia ilocosnorte travelphotography nationalheritage historicalplaces northernluzon manmadestructures oldstructures nationallandmark philippinetourism traveldestination mywinners philippineislands anawesomeshot ilocosregion spanishbuildings sunrisesilhouette luzonisland laoagdioscese oldspanishbuilings philippinelandmarks geodeticengineering philippinemuseum
"Dali! Pas-pasa ninyo!" (All In A Day's Rush) (C L E E () ) Tags: travel sea tourism photoshop landscape boats photography photo action philippines photographers tourists rush cebu photographicart cebucity scenics techniques banca wharfs nikonphotos tutorials postprocessing travelphotography boatscenes actionphotos philippinetourism nikonians badjaos layag creativephotos nikonpictures nikoncameras photoshoptutorials creativedigitalphotography nikond40x teampilipinas filipinophotographers philippinephotographer digitalimageer cleevillasor cebuphotography waterpiers philippineevents
Bora Reflection (ibarra_svd) Tags: vacation reflection tourism beach water canon fun eos sand break play philippines shore recreation lowtide boracay picnik bonding aklan canondigitalcamera beachfun summerbreak boracayisland beachgame philippinetourism wowphilippines boracaybeach beachplay flickraward malayaklan canondigitalrebelkiss teampilipinas canoneos450d balabag worldtrekker canondigitalrebelxsi 7100islands barfabella anthonyibarrafabella asiantourism barf2009 ibarrasvd mtrtrophyshot ibarrafabella bondingactivity pcp2011
Isla Verde 2 (ibarra_svd) Tags: city travel pink sea sun mountain verde tourism silhouette fog clouds philippines olympus batangas isla islaverde roro darkclouds calapan ilijan philippinetourism philippinetravel calabarzon teampilipinas batangasphilippines cloudsilhouette ormindoro southerntagalog mimaropa verdeislandpassage sp10uz calapanormindoro pcp2011
Belfry (Argao, Cebu) (C L E E () ) Tags: travel sun tourism church architecture facade bells photoshop photography gold golden nikon ruins flickr photographer bricks philippines towers churches landmarks textures cebu fabulous cebucity sunrays travelphotography goldenglobe heritagesites belfy nikon philippinetourism cebutouristspots award avision travelphotographer creativedigitalphotography nikond40x teampilipinas tourismspots cleevillasor cebuphotography cebuphotographyclub larawangpinoy nikonflickraward digitalimageercom cebuheritagesites
On the Footbridge (Storm Crypt) Tags: tourism river philippines bohol pilipinas loboc lobocriver philippinetourism ecotours
"Do not devise harm against your neighbor, while he lives securely beside you." ~ Proverbs 3:29 (pickled_newt ( busy again on n off B)) Tags: tourism beach bike bicycle photography message image edited philippines christian hdr coconuttrees bantayanisland philippinetourism nikond90 proverbs329 donotdeviseharmagainstyourneighbor
Caluangan Lake, Calapan City, Or. Mindoro, Philippines (ibarra_svd) Tags: hdr hiddenlake calapan freshwaterlake philippinetourism wowphilippines calapancity philippinelakes caluanganlake ormindorohiddenlake
Crater Lake Viewing Area (Storm Crypt) Tags: people plants mountain lake tourism water rock fog stone clouds fence volcano lava sand asia southeastasia warm waterfront philippines tragedy caldera shore vegetation craterlake sulfur silicon sulfurdioxide mtpinatubo pinatubo magma h20 pilipinas luzon mtmayon rainwater pampanga mountainrange tarlac zambales stratovolcano dioxide pyroclastic activevolcano viewingdeck philippinetourism mountpinatubo bulkan pacificringoffire centralluzon philippinehistory luzonisland philippinevolcano
Taal Lake and Volcano (ibarra_svd) Tags: blue lake tourism water canon volcano asia zoom philippines bluewater canondslr tagaytay taal picnik touristspot pilipinas canondigitalcamera taalvolcano talisay philippinetourism tagaytaycity taalbatangas regioniv canoneos450d philippinetouristspot southerntagalog canondigitalrebelxsi asianvolcano philippinevolcano asianlake philippinelake philippinetouristattraction lakeandvolcano
My bounty and love (JoLiz) Tags: sea seascape tourism view philippines deck cebu cebucity hdr channel mactan amara liloan camotes philippinetourism
Its Swimming Time (Storm Crypt) Tags: blue sea sky cloud sun tourism beach clouds swimming island marine asia southeastasia earth philippines bluesky science tourist resort snorkeling shore coastline seashore pilipinas puertoprincesa palawan beachresort snakeisland earthscience beachhead summershot philippinetourism wowphilippines hondabay
all yours (ontheraks (slow and getting slower waaa)) Tags: ocean blue beach water skies philippines blueskies whitesand mindanao glan philippinetourism socsargen saranggani
Mayon Volcano (jobarracuda) Tags: volcano asia philippines bicol cagsawaruins daraga albay philippinetourism wowphilippines asiantour mountmayon jobarracuda jojopensica pensica philippinelandmark fotocompetition fotocompetitionbronze cagsawachurch oliverpensica philippinetouristdestination
An Island in Busuanga (ibarra_svd) Tags: ocean sea sky mountains tourism water rock clouds canon sand asia philippines bluewater sandbar bluesky whitesand canondslr pilipinas palawan whiteclouds canondigitalcamera sandbars busuanga philippinetourism wowphilippines philippinearchipelago filipinophotography pinoyphotography northernpalawan canondigitalrebelkiss teampilipinas canoneos450d worltrekker southerntagalog philippinesceneries canondigitalrebelxsi 7100islands regionivb barfabella anthonyibarrafabella philippinescenery asiantourism barf2009 ibarrasvd barsvd ibarrafabella northernpalawanislands
Rain Over Mt. Halcon (ibarra_svd) Tags: mountains rain clouds philippines ricefields darkclouds mindoro calapan philippinetourism philippinemountains calapancity ormindoro tropicalmountains asianmountains mindorotourism southeastasianmountains
77 Legends of Sugarlandia - The Hari ng Negros Body Paint and Tribal Fashion Show (C L E E () ) Tags: show party music male tourism colors girl beautiful beauty muscles fashion silhouette festival female night wonderful dark star dance samba pretty fiesta shadows dancing fashionphotography background models performance young festivals dancer bodypaint legendary celebration event entertainment ornaments legends dumaguete glam shows mystical nightlife bodypainting acrobats fusion fashionshow adorn pageant performer legend eclectic hunks feisty negros acrobatic edgy travelphotography pageantry pintaflores negrosoccidental malebeauty dumaguetecity philippinetourism accoutrement orientalnegros femalebeauty eventsphotography philippinefestivals philippinetours eventsphotographer haringnegros sugarlandia legendsofsugarlandia colorfulshows
2 PINTAFLORES: The Legends of SUGARLANDIA (Hari Ng Negros | Body Paint & Tribal Fashion Show) (C L E E () ) Tags: show flowers decorations party music woman male tourism colors girl beautiful beauty fashion silhouette festival female night wonderful dark star dance samba pretty fiesta shadows dancing fashionphotography background crowd models young festivals dancer bodypaint legendary celebration event entertainment musical ornaments sound legends dumaguete glam shows mystical nightlife bodypainting fusion fashionshow adorn pageant legend eclectic feisty negros travelphotography pageantry pintaflores negrosoccidental malebeauty dumaguetecity philippinetourism accoutrement ornamentals orientalnegros femalebeauty eventsphotography philippinefestivals philippinetours eventsphotographer haringnegros sugarlandia legendsofsugarlandia colorfulshows
Mother & Child (C L E E () ) Tags: ocean poverty city travel sea tourism port photoshop landscape boats photography living pier boat photo nikon child action philippines families poor mother paddle lifestyle tourists rush tribes cebu ripples photographicart tribe cebucity motherandchild gypsies scenics techniques banca wharfs indigenouspeople nikonphotos tutorials postprocessing seagypsies boatpeople travelphotography boatscenes actionphotos philippinetourism nikonians badjaos layag stoppoverty sakayan creativephotos nikonpictures nikoncameras indigenoustribes photoshoptutorials creativedigitalphotography nikond40x teampilipinas filipinophotographers philippinephotographer digitalimageer cleevillasor cebuphotography waterpiers philippineevents travelcebu
Mayon Volcano (jobarracuda) Tags: volcano philippines bicol mayonvolcano philippinetourism wowphilippines perfectcone jobarracuda jojopensica philippinestouristdestination oliverpensica itsmorefuninthephilippines
Mayon Volcano, Philippines - April 2010 (ibarra_svd) Tags: volcano philippines mayon mtmayon legazpi albay mayonvolcano philippinetourism wowphilippines legazpicity philippinevolcano
4 The Legends of SUGARLANDIA (Hari Ng Negros | Body Paint & Tribal Fashion Show) (C L E E () ) Tags: show flowers party music woman male tourism colors girl beautiful beauty muscles fashion silhouette festival female night wonderful dark star dance samba pretty fiesta shadows dancing fashionphotography background models young festivals dancer bodypaint legendary celebration event entertainment ornaments sound legends dumaguete glam shows mystical nightlife bodypainting fusion fashionshow adorn pageant legend eclectic hunks feisty negros edgy travelphotography pageantry pintaflores negrosoccidental malebeauty dumaguetecity philippinetourism accoutrement orientalnegros femalebeauty eventsphotography philippinefestivals philippinetours eventsphotographer haringnegros sugarlandia legendsofsugarlandia colorfulshows
devotion (feast of black nazarene) (dolcevitalux) Tags: tourism christ cross philippines religion jesus manila devotion christianity devotees catholicism christians indulgence sacrifice quiapo jesuschrist penitence nazarene philippinetourism feastofblacknazarene dolcevitalux
81 Legends of Sugarlandia - The Hari ng Negros Body Paint and Tribal Fashion Show (C L E E () ) Tags: show party music male tourism colors girl beautiful beauty muscles fashion silhouette festival female night wonderful dark star dance samba pretty fiesta shadows dancing fashionphotography background models performance young festivals dancer bodypaint legendary celebration event entertainment ornaments legends dumaguete glam shows mystical nightlife bodypainting acrobats fusion fashionshow adorn pageant performer legend eclectic hunks feisty negros acrobatic edgy travelphotography pageantry pintaflores negrosoccidental malebeauty dumaguetecity philippinetourism accoutrement orientalnegros femalebeauty eventsphotography philippinefestivals philippinetours eventsphotographer haringnegros sugarlandia legendsofsugarlandia colorfulshows
Boatman (ibarra_svd) Tags: ocean travel sea people nature asian boat fishing fisherman asia southeastasia fishermen philippines photojournalism olympus filipino pinoy boatman pangasinan alaminos hundredislands lucap philippinetourism wowphilippines philippinetravel olympusdigitalcamera olympussp510uz teampilipinas lucapalaminospangasinan alaminospangasinan 7100islands westpangasinan repuiblicofthephilippines
What a wonderful world (docjabagat) Tags: blue sea sky beach nature philippines cebu philippinetourism wowphilippines barili cebuprovince mywinners worldtrekker barilicebu cebuislands
What's Down There? (Storm Crypt) Tags: travel boy sea seascape tourism beach swimming island sand child waterfront philippines shoreline floating diving resort snorkeling shore raft ilocos float whitesand southchinasea luzon pagudpud seawater saud ilocandia philippinetourism wowphilippines cleansea mywinners superbmasterpiece ilocosregion luzonisland norhternluzon traveldestingaions ilocosresort ilocandiaresort bayofsaud
15th Hot Air Balloon Show (Kuya D) Tags: angeles philippines clark hotairballons 2010 pampanga philippinetourism pinoykodakero nikond300 tokina1116mm 15thhotairballoonshowclarkangelespampangaphilippinesfeb12
La Paz Sand Dunes Hillside (Storm Crypt) Tags: park travel cruise hot landscape nationalpark sand desert dunes philippines hill melgibson parks dry tomcruise valley summit vegetation movies ilocos silicon sandscape gibson barren madmax lapaz arid isolated sanddunes laoag humid luzon fpj ilocosnorte travelphotography treeless notrees northernluzon desertvegetation philippinetourism wowphilippines northluzon philippineislands aplusphoto superbmasterpiece ilocosregion lapazsanddunes ilocosnationalpark philippinespark philippinedestinations
Pagsanjan Falls (TON70) Tags: falls laguna pagsanjan pagsanjanfalls philippinetourism
I'd shine in your eye like a jewel... (digiphotoxpress 2009) Tags: garden island philippines cebu cave buho poro camotes philippinetourism bukilat
Gateway to the Underground River (ibarra_svd) Tags: reflection green tourism water canon river boats asia philippines greenriver canondslr picnik banca palawan greenwater undergroundriver canondigitalcamera canoncamera philippinetourism wowphilippines flickraward canondigitalrebelkiss philippinetouristspots canoneos450d colourartaward canondigitalrebelxsi barfabella anthonyibarrafabella ibarrafabella pcp2011
Docking Sequence (Storm Crypt) Tags: blue sea sky shells tourism beach water stone island islands coast boat sand marine waterfront philippines cottage shoreline resort hut shore coastline approach seashore tropics cluds beachfront seacoast clearwater marinelife puertoprincesa palawan docking seawater nipahut philippinetourism hondabay philippineisland starfishisland philippinesislands easternpalawan
The Daraga Church (jobarracuda) Tags: philippines mayon bicol oldchurch daraga albay philippinetourism wowphilippines daragachurch jobarracuda jojopensica pensica nationalculturaltreasure oliverpensica
THE BEAUTIES OF NORTHERN PHILIPPINES (larryorquejr) Tags: gay philippines sunflowers gown ilocos parola ilocosnorte ilocano capebojeador philippinetourism pasuquin iloco sunflowerorganization
Tamaraw Falls, Puerto Galera, Or. Mindoro (ibarra_svd) Tags: travel trees nature water ecology forest philippines olympus waterfalls naturalbeauty naturalwonder puertogalera pilipinas ecotourism tamarawfalls tamaraw virginforest philippinetourism beautyofnature olympuscamera olympusdigitalcamera olympussp510uz teampilipinas worldtrekker ormindoro southerntagalog mimaropa santeodoroormindoro mindorotouristspots naturalresorces ecologicalwonder philippinetouristattraction
BAJAO BLUES (C L E E () ) Tags: ocean poverty city travel sea tourism port photoshop landscape boats photography living pier boat photo nikon child action philippines families poor mother paddle lifestyle tourists jade rush tribes cebu waters ripples photographicart tribe cebucity rippling emerald motherandchild gypsies scenics techniques banca wharfs indigenouspeople nikonphotos tutorials postprocessing seagypsies boatpeople travelphotography boatscenes actionphotos philippinetourism nikonians badjaos layag stoppoverty sakayan creativephotos nikonpictures nikoncameras indigenoustribes photoshoptutorials creativedigitalphotography nikond40x teampilipinas filipinophotographers philippinephotographer digitalimageer philippinetravels cleevillasor cebuphotography waterpiers philippineevents travelcebu garbongbisaya
anger (PaparazSea ) Tags: macrophotography philippinetourism muckdiving coolfish diveanilao junlao divephilippines anilaodiving anilaocritters crittersanilao paparazsea scubadiveanilao howtogettoanilao junvlao
Punong Lagoon (Storm Crypt) Tags: travel trees lake southwest tourism nature philippines bank places lagoon cebu sugbo visayas pilipinas freshwater nipa cpd seawater travelphotography brackish philippinetourism wowphilippines southwestcebu philippinestravel cebutourism centralvisayas punong region7 samboan southerncebu regionvii garbongbisaya kasadpan samboancebu punongsamboancebu punongsamboan


page:          1        2        3 
size:     -      

50 philippinetourism 39 philippines 28 tourism 21 wowphilippines 17 travel 15 travelphotography 14 sea 11 asia water 10 teampilipinas 9 pilipinas cebu beach 7 shore sky sand ocean photography southeastasia palawan 6 philippineislands ilocosregion silhouette nature luzonisland cebucity luzon landscape ilocos clouds volcano blue 5 creativedigitalphotography lake architecture cleevillasor waterfront photoshop shadows 4 mystical feisty canondigitalrebelxsi samba dancing background festivals fashion dark festival beauty pcp2011 shows bicol albay negrosoccidental garbongbisaya eventsphotography models show event ilocosnorte pageant adorn stone rocks dancer bodypaint northernluzon dance nikon ornaments seawater southerntagalog legends wonderful southchinasea banca nightlife malebeauty music rock legend entertainment young beautiful negros night male nikond40x female bodypainting fusion girl accoutrement pageantry fashionphotography colors resort olympus boats legendary landmarks philippinetours haringnegros pretty sugarlandia dumaguetecity eventsphotographer fiesta eclectic star fashionshow philippinefestivals colorfulshows boat orientalnegros legendsofsugarlandia canon celebration canondigitalcamera glam canoneos450d mywinners cebuphotography bricks party femalebeauty island pintaflores dumaguete 3 marine oliverpensica worldtrekker shoreline ibarrafabella scenics photographicart nikonpictures puertoprincesa mountain ilocandia photo river sun picnik heritage calapan canondslr philippineevents city rush canondigitalrebelkiss philippinevolcano waterpiers techniques cave earth tutorials wharfs creativephotos bluesky hunks boatscenes tourists photoshoptutorials child digitalimageer coastline whitesand anthonyibarrafabella barfabella philippinephotographer actionphotos 7100islands nikonians badjaos seascape ormindoro jojopensica edgy pampanga postprocessing layag jobarracuda hill nikoncameras muscles vegetation nikonphotos hdr filipinophotographers action philippinetouristattraction belltower brackish stratovolcano boatpeople diving mountains trees swimming philippinetravel church poverty westernpalawan mimaropa olympussp510uz acrobats indigenouspeople rain coast tarlac asiantourism marinelife ruins daraga people tourist spanishstructures paddle museum motherandchild lifestyle oldspanishbuildings travelcebu coconuttrees performance clearwater gypsies sound poor darkclouds performer snorkeling caldera mactan activevolcano mayon mtpinatubo green northluzon catholicchurch islands beachresort stoppoverty reflection centralluzon buildings seagypsies port families silicon flickr superbmasterpiece ibarrasvd civilengineering stones fog barf2009 history living woman undergroundriver touristspot hondabay ecotourism sakayan lava pinoykodakero tribe falala flowers seashore calapancity acrobatic textures ripples pensica cebuphotographyclub forest structures geology craterlake bluewater pier freshwater camotes antique ilocossur goldenglobe olympusdigitalcamera zambales mayonvolcano stalagmites capebojeador nikond90 stalactites indigenoustribes flickraward formations manmadestructures mtmayon

Pairs: 11 philippines,philippinetourism 4 philippines,wowphilippines 3 beach,philippines beach,philippinetourism philippines,tourism philippinetourism,wowphilippines philippinetourism,tourism 2 philippines,volcano philippinetourism,volcano jobarracuda,philippines cebu,philippines

Users: Storm Crypt 15 ibarra_svd 10 C L E E ٩(̾●̮̮̃̾•̃̾)۶ ™ 9 jobarracuda 3 SweetCaroline♥ JoLiz ontheraks (slow and getting slower waaa) Kuya D TON70 PaparazSea ♑ docjabagat pickled_newt ( busy again on n off B) dolcevitalux digiphotoxpress 2009 larryorquejr Tomasito.!


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.