abandoned autumn aves beach beautiful bergencounty bird birds bridge canon city clouds colors construction fireengine hudsoncounty jerseyshore manhattan middlesexcounty monmouthcounty nature newark newjersey newyork newyorkcity nice nj ny nyc ocean shorebird sky storm summer sun sunrise sunset tree trees unitedstates urban usa water weather zip07735

newjersey,nj Flickr Hive Mind Users: Dendroica cerulea jag9889 LennyNJ Triborough Tombo Pixels Tony Fischer Photography FOTOGRAFIA.Nelo.Esteves Steve Maciejewski Owl's Flight Matt Bango drp (more)  Preferences  Add to Flipboard
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Year   Advanced 

Welcome to Flickr Hive Mind, almost certainly the best photo search engine on the web. Returning logged in users may need to re-authenticate for FHM to work properly (go to preferences, log out, log in)

Dropbox storage - get 20 GB of Cloud Storage for free.

 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/newjersey,nj Hits: 542239 Pages: 10845 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
Parade Drumline (Mark Sardella) Tags: newjersey nj parade bands fourthofjuly wakefield marchingband july4th independenceday julyfourth wakefieldma wakefieldmassachusetts marksardella holynamecadets wakefieldindependencedayparade wakefieldparade
Suffern Fire Department Ladder 19-99 (Triborough) Tags: newjersey nj firetruck fireengine ladder tiller seagrave sfd montvale tda bergencounty suffernfiredepartment ladder1999
North Bergen,NJ in the mid 1940s (LennyNJ) Tags: newjersey nj 1940s northbergen hudsoncounty
White-tailed Deer (Dendroica cerulea) Tags: summer mammal newjersey nj deer rutgersuniversity mammalia whitetail whitetaileddeer odocoileus odocoileusvirginianus cervidae middlesexcounty artiodactyla rutgersecologicalpreserve livingstoncampus capreolinae
Opaque Openings (Owl's Flight) Tags: abandoned film hospital newjersey decay empty nj rusty bronica vacant collapse seethrough crusty disuse holey etrsi ofp greystoneparkpsychiatrichospital greystonehospital ektar100 kevinhooa gpph
Lake Como/South Belmar entrance (LennyNJ) Tags: newjersey nj jerseyshore
All Women Lifeguard Tournament 2013 (Hypnotica Studios Infinite) Tags: usa beach sports newjersey nps sandy asburypark nj teens competition lifeguard tournament teen longbeachisland bikini capemay nationalparkservice belmar swimsuit jerseyshore avon bayhead sandyhook seasideheights longbranch pointpleasant seasidepark seagirt beachpatrol spbp shbp lbbp strongerthanthestorm
9/11 was an Inside Job! (jag9889) Tags: city nyc ny newyork building site newjersey construction manhattan worldtradecenter 911 nj police center financialdistrict wtc groundzero department command portauthority officers 9112001 91101 10048 panynj papd zip10048
American Goldfinch (hjhipster) Tags: usa nature birds yellow newjersey wildlife nj sigma finch stoneharbor migratory 2009 birdsanctuary americangoldfinch carduelistristis capemaycounty nikond60 wildcanary easterngoldfinch sevenmileisland sigma120400 120400mm sigma120400mm birdsofnewjersey jerseybirding sigma120400mmapodghsm hjhipster stoneharborbirdsanctuary
This Old House (Billtacular) Tags: bird newjersey birding nj birdhouse capemay swallow treeswallow capemaystatepark thewonderfulworldofbirds
Freddy at the Controls (sullivan1985) Tags: me newjersey nj el 18 garfield erielackawanna 3372 urhs c424 morristownanderie u34ch
Plane crashes into apartment building (LennyNJ) Tags: newjersey nj 1956 apartmentbuilding planecrash northbergen hudsoncounty
Newark Fire Department Engine 19 (Triborough) Tags: newjersey essexcounty nj engine firetruck fireengine newark eone nfd newarkfiredepartment engine19
Chrysler (quiggyt4) Tags: city nyc newyorkcity november autumn urban sun ny newyork fall nature colors weather silhouette skyline architecture clouds skyscraper sunrise nbc dawn newjersey construction chinatown skyscrapers purple crane manhattan broadway nj cities sunny cranes midtown cnn esb nyskyline hudsonriver empirestatebuilding nytimes gothamist unioncity chryslerbuilding urbanism nyt newyorklifebuilding nycskyline weehawken eastbroadway wabc hudsoncounty ronpaul theweatherchannel ows occupy nytimesbuilding hudsonyards iwitness hudsoncountynj cnnireport occupywallstreet 432parkavenue 432park
Semipalmated Sandpiper (Matt Bango) Tags: nature birds canon newjersey wildlife nj 7d peep sandpiper shorebird wildbirds semipalmatedsandpiper 600mm nummyisland
Heaven (drp) Tags: fish eye scales gills boat macro newjersey nj
Orchard Orbweaver (e_monk) Tags: wild usa macro nature animal geotagged spider newjersey unitedstates arachnid nj somerville stuff creativecommons animalia arthropoda arachnida orbweaver hillsborough arthropod araneae rjs tetragnathidae longjawedorbweaver leucauge chelicerata ecdysozoa araneomorphae orchardorbweaver leucaugevenusta attributionnoncommercialsharealike eukaryota southbranch eumetazoa ccbyncsa araneoidea sal100m28 taxonomy:kingdom=animalia taxonomy:class=arachnida taxonomy:order=araneae taxonomy:phylum=arthropoda taxonomy:subphylum=chelicerata taxonomy:family=tetragnathidae sonyalphaa700 macro1to1 taxonomy:genus=leucauge taxonomy:suborder=araneomorphae taxonomy:binomial=leucaugevenusta taxonomy:common=orchardorbweaver lvenusta taxonomy:domain=eukaryota taxonomy:species=lvenusta taxonomy:superphylum=ecdysozoa taxonomy:subkingdom=eumetazoa taxonomy:superfamily=araneoidea 2012emonk geo:lat=4054351009 geo:lon=7469432294
Keyport Yacht Club (FOTOGRAFIA.Nelo.Esteves) Tags: usa storm beautiful marina boats us newjersey interestingness nice unitedstates great nj 2006 explore monmouthcounty sailboats bayshore ernesto konicaminolta keyport views500 dimagex1 neloesteves zip07735 keyportyachtclub 20060904
Naturally, the Hat... (Tony Fischer Photography) Tags: music festival newjersey louisiana dancing neworleans nj crawfish blues gratefuldead augusta garcia cajun deadhead crawfishfestival sussexcounty diamondclassphotographer flickrdiamond crawfishfest zydecko
Snow Fall In The Night (FOTOGRAFIA.Nelo.Esteves) Tags: winter usa snow storm beautiful weather night wow spectacular newjersey cool nice nikon pretty unitedstates gorgeous awesome great nj super monmouthcounty neat lovely 2008 bayshore 55200mm unionbeach views100 d80 neloesteves zip07735
Short-billed Dowitcher (Dendroica cerulea) Tags: summer bird newjersey calidris nj aves sandpiper somersetcounty shorebird leastsandpiper dowitcher limnodromusgriseus shortbilleddowitcher charadriiformes calidrisminutilla limnodromus scolopacidae warrentownship glenhurstmeadows scolopaci
Foliage in Edgewater, New Jersey (jag9889) Tags: autumn trees colors landscape newjersey nj foliage edgewater bergencounty 07020 zip07020 vision:mountain=076 vision:sky=0762 vision:outdoor=0987 vision:clouds=0703
A mess of boards and a fallen tree (Dendroica cerulea) Tags: trees forest newjersey spring nj boardwalk highlandpark fallentree middlesexcounty highlandparkmeadows
Happy Thanksgiving!!! From Ocean City New Jersey (Steve Maciejewski) Tags: ocean thanksgiving sunrise newjersey nj ocnj oceancitynewjersey surfbeach vision:text=0643 vision:beach=0566 vision:sunset=0817 vision:outdoor=0822 vision:clouds=0899 vision:sky=0961 vision:car=0714 vision:ocean=0926
 (break.things) Tags: abandoned newjersey nj
A Day On The Construction Site (44) (jq gaines) Tags: cameraphone abstract newjersey construction nj tiles constructionsite iphone thegardenstate mobilephotography iphone5s vscocam
Untitled #230 (Ryan Christopher VanWilliams - NYC) Tags: nyc newyorkcity red sculpture ny newyork abstract black art beautiful beauty fashion digital fun flying newjersey women noir williams princess flash goddess christopher nj pearls financialdistrict queens cube editorial hanging wallstreet noguchi vivitar couture redflower allure avantgarde nuevayork littleblackdress blackdress blackwoman redcube highfashion 2800 vivitar2800 williamsi vanwilliams rvw nuevajersey urbanluxury rcvw fashionindustrynetwork redcubeisamunoguchi dakira ryanchrisophervanwilliams armstrongcarla isamunoguchrcvwryan vanwilliamsfranchesca guerreronicole luenicolette lueyanni
Sequence (Nunziray) Tags: newjersey jump skateboarding air nj ollie skate skateboard sequence mattboyd raynunzi joelmorgenwick
DSC_2531-1 lomo (glhs279) Tags: sunset sky clouds newjersey lomo jerseycity nj libertystatepark newyorkharbor d600
Frog (Sujit Mahapatra) Tags: usa color green public colors newjersey funny cartoon nj frog sujit mahapatra theperfectphotographer sujitphotography
361 - Stroll in the Rain (riffyski) Tags: park green rain canon project newjersey nj parks project365
Savannah Sparrow (Dendroica cerulea) Tags: autumn birds newjersey nj aves sparrow highlandpark savannahsparrow emberizidae passeriformes passerculussandwichensis middlesexcounty passerculus passeri donaldsonpark passerida passeroidea psittacopasserae eufalconimorphae
The holy grail of hot dog-dom (mar_nyc) Tags: food hotdog newjersey chili fastfood nj americana hotdogs roadhouse honkytonk ruttshut cliffton
man in uniform 2 (rich701) Tags: vintage newjersey pipe nj smoking smoker dix pipesmoker burlingtoncounty fortdix campdix
DELMARVA POWER's Atlantic City Electric (Power Pole Scale Modeler) Tags: newjersey nj pole jersey poles southjersey delmarva pepco utilitypoles atlanticcityelectric delmarvapower pepcoholdings atlanticelectric
Eastern Hemlock (Dendroica cerulea) Tags: summer tree newjersey nj hemlock conifer morriscounty pinophyta pinaceae jeffersontownship fav10 tsuga easternhemlock tsugacanadensis pinopsida pinales mahlondickersonreservation abietoideae
Blue-winged Teal, flying (Tombo Pixels) Tags: bird flying duck inflight newjersey nj bluewingedteal negrinepote twb1 slbflying photocontesttnc13 negrinepote130310
 (.tom troutman.) Tags: abandoned 120 mamiya film analog hospital mediumformat newjersey kodak decay nj 7 100 6x7 asylum ektar kirkbride
collete sleeping-800 (justingaynor) Tags: ocean sunset vacation people beach water sunrise harbor boat newjersey sand nj shell crab august shore jersey stoneharbor
2009 07 05 - 7171 - Barnegat Light - Advertising Airplane (thisisbossi) Tags: usa advertising marketing us newjersey unitedstates aircraft airplanes nj planes banners oceancounty fixedwing highwing
Manhattan Sunrise (pmarella) Tags: city nyc newyorkcity morning trees sky urban usa newyork color reflection water skyline clouds sunrise fence reflections river landscape newjersey solitude cityscape shadows manhattan nj silhouettes whatever pmarella metropolis hudsonriver empirestatebuilding empirestate tranquil hoboken donttrythisathome hudsoncounty amomentintime onthewaterfront sigma1770mm riverviewpkproductions icoverthewaterfront myeyeshaveseenthis eos7d
Musk Turtle at White Lake (Tombo Pixels) Tags: newjersey turtle nj musk whitelake muskturtle twb1 naturewalk2014 whitelake140579
Explorer (Chris Bartow) Tags: tree clouds canon newjersey meetup nj explore sandyhook instagram instameet
On Watch (willpix) Tags: ocean summer usa sun beach monochrome clouds america newjersey nj atlantic ac ricoh willpix
"January 1, 2012 (Keegan)" (B.C. Lorio) Tags: newjersey nj streetphotography streetportrait finepix fujifilm newyearsday 2012 plainfield x100 january1
The Egg Platter Diner (Outside, Corner) (Tony Fischer Photography) Tags: breakfast lunch restaurant newjersey egg nj diner eggs paterson openallnight eggplatter passaiccounty urbanamerica crooksavenue
Barnegat Bay Sunset (Garden State Hiker) Tags: sunset shadow summer orange sun clouds bay newjersey nj august jerseyshore silhoutte barnegatbay
IMG_1380 (sqrphoto) Tags: bridge water canon waterfall newjersey nj paterson hdr nationalhistoricalpark passaiccounty passaicfalls greatpalls
BRIDGE K058: Lincoln Highway Bridge over Passaic River, New Jersey (jag9889) Tags: bridge puente newjersey kayak crossing essexcounty nj bridges ponte kayaking pont newark brcke paddling waterway lincolnhighway kearny hudsoncounty passaicriver njdot bridgesbykayak k058 kayakbridgesset
 (jamie kathleen.) Tags: flowers grave death newjersey nj funeral cedarville oldstonecemetery vision:outdoor=099 vision:dark=0612

page:          1        2        3 
size:     -      



50 newjersey nj 9 usa 6 clouds 5 summer hudsoncounty 4 nature sunrise unitedstates newyork nyc canon 3 autumn trees birds sun city ocean middlesexcounty beautiful jerseyshore colors water sunset ny newyorkcity construction manhattan bird beach abandoned storm shorebird urban explore nice fireengine sky zip07735 bergencounty wildlife financialdistrict color august flying green passaiccounty film sandpiper firetruck paterson great aves weather newark monmouthcounty bridge tree skyline stoneharbor macro empirestatebuilding jersey landscape neloesteves highlandpark hudsonriver capemay us boat twb1 essexcounty northbergen bayshore abstract decay hospital sandyhook migratory fujifilm shore fixedwing pinales 120400mm 2800 iwitness asburypark breakfast orange marketing jeffersontownship waterway raynunzi urbanamerica 9112001 weehawken macro1to1 blackwoman broadway crusty k058 winter leucauge command bay dancing wakefieldindependencedayparade birding super apartmentbuilding silhouette chelicerata wild treeswallow kirkbride vision:car=0714 sujitphotography cranes easterngoldfinch inflight rain mammalia sevenmileisland conifer holynamecadets funeral smoker taxonomy:class=arachnida greatpalls me goddess planes mahapatra psittacopasserae fashion dowitcher mattboyd views500 project cool longbranch bridges southjersey festival beauty death iphone5s leastsandpiper semipalmatedsandpiper swimsuit calidris 1940s geo:lon=7469432294 lvenusta lbbp odocoileus eye garfield roadhouse passaicfalls park lincolnhighway sujit nycskyline negrinepote newyorkharbor vscocam pmarella luenicolette emberizidae people november metropolis oceancounty wow nytimesbuilding shbp eone newyorklifebuilding vanwilliams ronpaul barnegatbay musk bronica vintage crane fish hotdogs planecrash gills pipe limnodromusgriseus police thanksgiving whitetail zip10048 monochrome attributionnoncommercialsharealike skateboard asylum 100 nyt sand slbflying rcvw 120 banners independenceday utilitypoles sigma1770mm limnodromus ladder wabc parade dimagex1 blues collapse wakefieldmassachusetts geotagged chili passerida ows animal thewonderfulworldofbirds ektar100 araneae scolopaci spider crooksavenue sculpture river sussexcounty deadhead hudsonyards williams ccbyncsa egg 2012 432park wtc unioncity fourthofjuly rjs constructionsite cliffton avantgarde abietoideae diner nfd d600 purple queens ryanchrisophervanwilliams nikon rutgersuniversity pipesmoker pole art worldtradecenter vision:sky=0961 gpph nyskyline food vacation redflower naturewalk2014 campdix cartoon creativecommons gorgeous wakefieldparade 911 nps gothamist x100 flash myeyeshaveseenthis zydecko solitude 6x7 birdhouse vision:clouds=0899 negrinepote130310 sparrow building swallow vision:mountain=076 warrentownship scolopacidae 7d shell nikond60 arthropod armstrongcarla seasidepark thegardenstate ruttshut sailboats turtle finepix sequence keyport 7 u34ch officers passeriformes hanging greystonehospital

Pairs: 31 newjersey,nj 4 newjersey,summer nj,summer canon,nj canon,newjersey 3 newjersey,sunset nj,usa newjersey,ocean clouds,nj newjersey,usa nj,sunset

Users: Dendroica cerulea 5 jag9889 3 LennyNJ Triborough Tombo Pixels Tony Fischer Photography FOTOGRAFIA.Nelo.Esteves Steve Maciejewski Owl's Flight Matt Bango drp Ryan Christopher VanWilliams - NYC riffyski sqrphoto willpix hjhipster pmarella Power Pole Scale Modeler thisisbossi jq gaines Billtacular break.things e_monk quiggyt4 Nunziray Hypnotica Studios Infinite Chris Bartow rich701 B.C. Lorio sullivan1985 justingaynor mar_nyc glhs279 jamie kathleen. Sujit Mahapatra .tom troutman. Garden State Hiker Mark Sardella


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.