beautiful ben berkshire big blue bridge by city colors county dark darkness england eye image images lake light lights london nei1523 neil night nightime photos pickin pickinimages playing reading refelction river shutter silhouette sky slow slowshutterspeed speed speeds sunny sunset thames trails uk water with

nei1523 Flickr Hive Mind Users: Pickin Images (more)  Preferences 
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Advanced 

The Flickr API has been buggy over the past few days, some searches are returning no results. Sorry for the troubles! -Nathan


I am a fan of Nicole Atkins's Music. Check her out!

-Nathan

 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/neil Hits: 60 Pages: 2 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
Westminster 2 (Pickin Images) Tags: county city uk bridge blue winter england color building london college colors beautiful by architecture night composition buildings wonderful dark landscape town big long cityscape colours darkness angle image flood ben photos britain weekend awesome centre low capital central cities trails cityscapes neil kingdom center images architectural clear nightime hour architektur british lovely metropolitan refelction pickin bight cites pickinimages nei1523
London Eye and County Hall (Pickin Images) Tags: county old bridge blue light sunset england sky house lake playing london eye tower clock beautiful westminster wheel silhouette by thames night river dark lights hall big exposure slow with riverside image little ben photos shaped flight shapes fast neil sunny images explore nightime headlight parliment refelction pickin speeds slowshutterspeed refelection refelections pickinimages nei1523
Westminster (Pickin Images) Tags: county city uk bridge blue winter england color building london college colors beautiful by architecture night composition buildings wonderful dark landscape town big long cityscape colours darkness angle image flood ben photos britain weekend awesome centre low capital central cities trails cityscapes neil kingdom center images architectural clear nightime hour architektur british lovely metropolitan refelction pickin bight cites pickinimages nei1523
London Eye 2 (Pickin Images) Tags: county city uk bridge blue winter england color building london eye college colors beautiful by architecture night composition buildings wonderful dark landscape town big long cityscape colours darkness angle image flood ben photos britain weekend awesome centre low capital central cities trails cityscapes neil kingdom center images architectural clear nightime hour architektur british lovely metropolitan refelction pickin bight cites pickinimages nei1523
St. Pauls HDR (Pickin Images) Tags: city uk travel urban color building london colors st by architecture night buildings reflections dark spectacular photography lights photo interestingness cityscape darkness cathedral image photos dusk centre cities cityscapes neil pauls landmark center icon images structure architectural explore nighttime nightime finepix londres architektur nights fujifilm sensational metropolis londra impressive nightfall pickin municipality edifice cites s6500fd s6000fd paulsthames pickinimages nei1523
Tower Bridge of London City (Pickin Images) Tags: old city bridge light england sky people playing tree london eye tower castle water car wheel silhouette st by thames night docks river reading lights golden big rocks long slow with heart motorway image ben photos trails fast neil images nightime shutter ark pickin slowshutterspeed kathrines pickinimages nei1523
Big Ben Gemma (Pickin Images) Tags: county old bridge blue light sunset england sky house lake playing london eye tower clock beautiful westminster wheel silhouette by thames night river dark lights hall big exposure slow with riverside image little ben photos shaped flight shapes fast neil sunny images explore nightime headlight parliment refelction pickin speeds slowshutterspeed refelection refelections pickinimages nei1523
St. Pauls HDR (Pickin Images) Tags: city uk travel urban color building london colors st by architecture night buildings reflections dark spectacular photography lights photo interestingness cityscape darkness cathedral image photos dusk centre cities cityscapes neil pauls landmark center icon images structure architectural explore nighttime nightime finepix londres architektur nights fujifilm sensational metropolis londra impressive nightfall pickin municipality edifice cites s6500fd s6000fd paulsthames pickinimages nei1523
Canary Wharf & The O2 (Pickin Images) Tags: london by night image photos neil images nightime pickin pickinimages nei1523
EcCeL MARINA & The O2 (Pickin Images) Tags: city urban orange london colors by night marina dark spectacular geotagged photo dock arquitectura cityscape darkness skyscrapers image photos dusk centre towers o2 cities royal cityscapes neil millenium center images victoria chain melody part nighttime 350 ii nightime wharf dome londres nights sensational metropolis canary alpha londra metropolitan impressive global nightfall pickin excel municipality cites unchained panoramafotogrfico saariysqualitypictures pickinimages nei1523
Barrier & O2 (Pickin Images) Tags: light sky cloud reflection london beach water by night river landscape long exposure ray nightshot image flood photos tide low o2 neil images explore shore nightime wise barrier xo hdr foreshore pickin congrats londonist londonistriverproject pickinimages nei1523
Big Ben (Pickin Images) Tags: county old bridge blue light sunset england sky house lake playing london eye tower clock beautiful westminster wheel silhouette by thames night river dark lights hall big exposure slow with riverside image little ben photos shaped flight shapes fast neil sunny images explore nightime headlight parliment refelction pickin speeds slowshutterspeed refelection refelections pickinimages nei1523
St. Katharine Docks, London UK (Pickin Images) Tags: city uk bridge blue sunset england house london eye tower water wheel st by thames skyline night marina docks river boats pier big twilight europe european view riverside image suspension ben photos britain dusk united capital great scenic ivory cities neil kingdom landmark images tourist nightime hour esplanade promenade british yachts katharine wetdock pickin kathrines pickinimages nei1523
Dinton Pastures (Pickin Images) Tags: sunset lake london water birds by night reading boat pond image photos neil images gemma swans nightime pastures launch berkshire decking pickin dinton 1523 pickinimages nei1523
Dinton Pastures (Pickin Images) Tags: sunset lake london water birds by night reading boat pond image photos neil images gemma swans nightime pastures launch berkshire decking pickin dinton 1523 virgiliocompany pickinimages nei1523
Dinton Pastures (Pickin Images) Tags: sunset lake london water birds by night reading boat pond image photos neil images gemma swans nightime pastures launch berkshire decking pickin dinton 1523 pickinimages nei1523
Slowing Falls *EXPLORED* (Pickin Images) Tags: light white lake playing london water beautiful by night speed river waterfall slow with image photos neil images nightime shutter l milky virgina pickin speeds slowshutterspeed cascaded pickinimages nei1523
Moonphase (Pickin Images) Tags: moon london by night canon video play with shot image zoom photos first neil images nightime dslr mode pickin moonphase 600d my pickinimages nei1523
Shiplake Boatyard *EXPLORED* (Pickin Images) Tags: old bridge light sunset summer sky lake playing tree london water beautiful field silhouette by thames night speed river dark reading lights golden boat canal rocks slow with heart image photos fast neil sunny images nightime shutter ark berkshire avon pickin speeds slowshutterspeed malard pickinimages nei1523
Tree of Silhouette (Pickin Images) Tags: old sunset summer sky tree london beautiful silhouette by night dark golden image photos neil images nightime pickin pickinimages nei1523
Ladybower Reservoir (Pickin Images) Tags: england game london motif by lady night bravo factory image photos district quality peak neil images national nightime superhero trust friendly thumbsup challenge challenges bower pickin yourock the naturesfinest bigmomma blueribbonwinner supershot magicdonkey specland specnature challengeyou challengeyouwinner anawesomeshot superaplus aplusphoto diamondclassphotographer flickrdiamond superhearts a3b challengefactory fotocompetitionbronze herowinner storybookwinner motifunam pickinimages nei1523
Virgina Water Cascade (Pickin Images) Tags: light white lake playing london water beautiful by night speed river waterfall slow with image photos neil images nightime shutter l berkshire milky virgina pickin speeds slowshutterspeed cascaded pickinimages nei1523
Twilight at Henley Bridge *EXPLORED* (Pickin Images) Tags: bridge light sunset people lake london castle water beautiful by thames night speed river dark reading lights coast boat canal duck pub rocks slow heart image photos seagull neil images swans nightime shutter ark avon henley pickin speeds slowshutterspeed malard pickinimages nei1523
Blue hour *EXPLORED* (Pickin Images) Tags: bridge sunset lake london water beautiful by thames night speed river reading lights boat duck pub slow image photos trails neil images nightime shutter ark henley pickin speeds slowshutterspeed pickinimages nei1523
Rush Hour *EXPLORED* (Pickin Images) Tags: sunset london eye cars water car wheel st by thames night docks river lights big image ben photos trails neil images surrey nightime rush hour a3 pickin kathrines pickinimages nei1523
Fly~By~Boat *EXPLORED* (Pickin Images) Tags: bridge light sunset lake playing bird london castle water beautiful by thames night speed river dark reading lights boat canal waterfall duck pub slow with motorway image photos seagull trails fast neil sunny images nightime shutter berkshire m4 virgina pickin speeds slowshutterspeed malard pickinimages nei1523
The Tiger Moth Wickenby Airport (Pickin Images) Tags: birthday london by night plane reflections airport image photos tiger flight moth neil images nightime whitby morris harding pickin airfield niel wickenby pickinimages nei1523
Pier 60, Florida (Pickin Images) Tags: london by night shopping image photos livemusic neil images nightime environment snackbar pickin crafters beachbars andtheview eventpavilion pickinimages sunsetcelebrationsrelaxandunwind asthesunsetshereareasuperwaytoendyourdayeverydayatclearwaterbeachitisacelebration asunsetcelebrationthroughouttheyear theeveningsunsetsaretreatedroyallywithafestivecrowdandartistsatclearwaterbeachspier60thepier60festivalvisitorscelebrateeachuniquegulfofmexicosunsetasafunandgrandoccasionthisstreetfestivalfeaturesartists andmusicalperformancesonclearwatersfamousfishingpierpier60visitorsandresidentscongregateeacheveningtosoakupthisfestiveenvironmentandenjoyoneofthebestspotsinfloridatowatchthesunsetpier60isa1 000footobservationandfishingareawithbaittackle andcoveredplaygroundforkidseachdayfromtwohoursbeforeuntiltwohoursaftersunsetartisansandperformersarefeaturedenjoythefun allforagreatpricefreeadditionally pier60offersaccesstogreatfinedining entertainmentandoutstandingwhitesandybeaches nei1523
Pelican Panic (Pickin Images) Tags: london by night image photos neil images nightime sometimes pickin pickinimages bpleasefeelfreetocheckoutmyahrefhttpwwwfacebookcompagespickinimagesphotography141658385923405relnofollowfacebook afollowmeonahrefhttpstwittercomneil1523relnofollowtwitteraoraddmeasaflickrahrefhttpwwwflickrcompeopleneil1523searchpickinimagescontactabpelicansareverylargebirdswithverylong terminallyhooked billscharacterisedbytheattachmentofahugegularpouchtheslenderramiofthelowerbillandtheflexibletonguemusclesformthepouchintoabasketforcatchingfishand rainwatertheyhavealongneckandshortlegswithlargefeetalthoughtheyappearbulkytheyarerelativelylightbecauseofairpocketsintheskeletonandbeneaththeskinsothattheyfloathighinthewater6thetailisshortandsquare with20to24feathersthewingsarelongandbroad suitablyshapedforsoaringflight andhavetheunusuallylargenumberof30to35secondaryflightfeathersthesmallestspeciesisthebrownpelican smallindividualsofwhichcanbeaslittleas275kg6lb 106cm42inlong andcanhaveawingspanofaslittleas183m6ftthelargestisbelievedtobethedalmatian atupto15kg33lb 183cm72inlong withamaximumwingspanof3mnearly10fttheaustralianpelicanhasthelongestbillofanybird nei1523
Westonbrit (Pickin Images) Tags: county city uk light sunset england sky lake color london eye colors field silhouette by night speed dark reading big long slow with darkness image photos weekend quality neil cotswolds images nightime shutter wiltshire refelction pickin speeds slowshutterspeed cotswold westonbrit pickinimages nei1523
Seasons Colour (Pickin Images) Tags: county city uk light sunset england sky lake color london eye colors field silhouette by night speed dark reading big long slow with darkness image photos weekend quality neil cotswolds images nightime shutter wiltshire refelction pickin speeds slowshutterspeed cotswold westonbrit pickinimages nei1523
Reedy Setting *EXPLORED* (Pickin Images) Tags: with water sunset speeds sunny hosehill speed shutter malard duck lake beautiful pond reeds reedy reading berkshire neil pickin images image pickinimages nei1523 london by night nightime photos
River Of Lanterns (Pickin Images) Tags: london by night image photos neil images nightime pickin pickinimages nei1523
Folridian Pelican (Pickin Images) Tags: sky london water beautiful silhouette by night speed with image photos neil sunny pelican images nightime shutter pickin pickinimages nei1523
Wings *EXPLORED* (Pickin Images) Tags: bridge lake playing bird london castle by wales night speed canal with image photos seagull flight fast neil sunny images nightime shutter avon pickin speeds pickinimages nei1523
Coate Water (Pickin Images) Tags: london by night image photos neil images nightime pickin pickinimages nei1523
_MG_2032 (Pickin Images) Tags: london by night image photos neil images nightime sometimes pickin pickinimages bpleasefeelfreetocheckoutmyahrefhttpwwwfacebookcompagespickinimagesphotography141658385923405relnofollowfacebook afollowmeonahrefhttpstwittercomneil1523relnofollowtwitteraoraddmeasaflickrahrefhttpwwwflickrcompeopleneil1523searchpickinimagescontactabpelicansareverylargebirdswithverylong terminallyhooked billscharacterisedbytheattachmentofahugegularpouchtheslenderramiofthelowerbillandtheflexibletonguemusclesformthepouchintoabasketforcatchingfishand rainwatertheyhavealongneckandshortlegswithlargefeetalthoughtheyappearbulkytheyarerelativelylightbecauseofairpocketsintheskeletonandbeneaththeskinsothattheyfloathighinthewater6thetailisshortandsquare with20to24feathersthewingsarelongandbroad suitablyshapedforsoaringflight andhavetheunusuallylargenumberof30to35secondaryflightfeathersthesmallestspeciesisthebrownpelican smallindividualsofwhichcanbeaslittleas275kg6lb 106cm42inlong andcanhaveawingspanofaslittleas183m6ftthelargestisbelievedtobethedalmatian atupto15kg33lb 183cm72inlong withamaximumwingspanof3mnearly10fttheaustralianpelicanhasthelongestbillofanybird nei1523
Pier 60, Florida (Pickin Images) Tags: london by night shopping image photos livemusic neil images nightime environment snackbar pickin crafters beachbars andtheview eventpavilion pickinimages sunsetcelebrationsrelaxandunwind asthesunsetshereareasuperwaytoendyourdayeverydayatclearwaterbeachitisacelebration asunsetcelebrationthroughouttheyear theeveningsunsetsaretreatedroyallywithafestivecrowdandartistsatclearwaterbeachspier60thepier60festivalvisitorscelebrateeachuniquegulfofmexicosunsetasafunandgrandoccasionthisstreetfestivalfeaturesartists andmusicalperformancesonclearwatersfamousfishingpierpier60visitorsandresidentscongregateeacheveningtosoakupthisfestiveenvironmentandenjoyoneofthebestspotsinfloridatowatchthesunsetpier60isa1 000footobservationandfishingareawithbaittackle andcoveredplaygroundforkidseachdayfromtwohoursbeforeuntiltwohoursaftersunsetartisansandperformersarefeaturedenjoythefun allforagreatpricefreeadditionally pier60offersaccesstogreatfinedining entertainmentandoutstandingwhitesandybeaches nei1523
Westonbirt Aliens! (Pickin Images) Tags: london by night image photos neil images nightime pickin pickinimages nei1523
Fun at the Fair (Pickin Images) Tags: show old bridge blue winter light summer england sky orange playing london eye water silhouette yellow rock by skyline night speed dark lights big silent slow view image zoom photos weekend quality wide neil slide images nightime wise shutter pickin speeds slowshutterspeed theoriginalgoldseal pickinimages nei1523
windmill at waltham *EXPLORED* (Pickin Images) Tags: blue trees light sky lake green london windmill beautiful by night image photos neil sunny images nightime waltham pickin pickinimages nei1523
Henley edited (Pickin Images) Tags: bridge sunset lake playing flower london castle water beautiful by thames night speed river dark reading lights boat canal duck pub rocks slow heart image photos trails neil images swans nightime shutter ark avon henley pickin speeds 2010 slowshutterspeed malard pickinimages nei1523
Pier 60, Florida (Pickin Images) Tags: sunsetcelebrationsrelaxandunwind asthesunsetshereareasuperwaytoendyourdayeverydayatclearwaterbeachitisacelebration asunsetcelebrationthroughouttheyear theeveningsunsetsaretreatedroyallywithafestivecrowdandartistsatclearwaterbeachspier60thepier60festivalvisitorscelebrateeachuniquegulfofmexicosunsetasafunandgrandoccasionthisstreetfestivalfeaturesartists crafters andmusicalperformancesonclearwatersfamousfishingpierpier60visitorsandresidentscongregateeacheveningtosoakupthisfestiveenvironmentandenjoyoneofthebestspotsinfloridatowatchthesunsetpier60isa1 000footobservationandfishingareawithbaittackle snackbar eventpavilion andcoveredplaygroundforkidseachdayfromtwohoursbeforeuntiltwohoursaftersunsetartisansandperformersarefeaturedenjoythefun livemusic environment andtheview allforagreatpricefreeadditionally pier60offersaccesstogreatfinedining beachbars shopping entertainmentandoutstandingwhitesandybeaches pickin images image pickinimages nei1523 neil london by night nightime photos
Twisted Hand (Pickin Images) Tags: county city uk light sunset england sky lake color london eye colors beautiful field silhouette by night speed dark reading big long slow with darkness image photos weekend quality neil cotswolds images nightime shutter wiltshire refelction pickin speeds slowshutterspeed cotswold westonbrit pickinimages nei1523
Dinton Pastures (Pickin Images) Tags: sunset london by night reading image photos neil images gemma nightime berkshire pickin dinton pickinimages hardingmorris nei1523
Halloween (Pickin Images) Tags: london by night image photos neil images nightime pickin pickinimages nei1523
Harmonious! *EXPLORED* (Pickin Images) Tags: london by night image photos neil images nightime pickin pickinimages nei1523
Still Life *EXPLORED* (Pickin Images) Tags: london by night image photos neil images nightime pickin pickinimages nei1523
Wanna be Me! (Pickin Images) Tags: london field by night image photos neil images nightime sunflower pickin flowergreensummerspringberkshirereachingforthelight pickinimages nei1523
Framed Bridge (Pickin Images) Tags: lake playing london water beautiful by night speed river with image photos neil sunny images nightime shutter framing berkshire virgina pickin refelections pickinimages nei1523


page:          1        2      
size:     -      

50 neil london night nei1523 image pickin by pickinimages images nightime photos 20 lake 19 sunset beautiful 18 dark water 16 shutter speeds with 15 light speed bridge slow river slowshutterspeed 14 reading 13 lights sky england big 12 playing 11 thames silhouette eye city 10 sunny 9 refelction colors ben berkshire darkness county uk blue 8 trails color boat long 7 old fast weekend cities 6 explore cityscape centre wheel cityscapes cites center 5 flight malard architectural canal tower st quality ark castle building swans hour architecture buildings architektur field duck 4 winter british pond dusk gemma heart riverside landscape capital rocks refelections flood pub metropolitan britain low dinton kingdom virgina exposure house avon 3 kathrines central andcoveredplaygroundforkidseachdayfromtwohoursbeforeuntiltwohoursaftersunsetartisansandperformersarefeaturedenjoythefun eventpavilion nights shapes spectacular wiltshire 1523 colours crafters college westonbrit seagull municipality birds landmark urban hall decking lovely snackbar reflections clock westminster tree asunsetcelebrationthroughouttheyear refelection henley metropolis shopping composition little shaped docks headlight town nightfall parliment waterfall cotswolds environment photo londra andmusicalperformancesonclearwatersfamousfishingpierpier60visitorsandresidentscongregateeacheveningtosoakupthisfestiveenvironmentandenjoyoneofthebestspotsinfloridatowatchthesunsetpier60isa1 allforagreatpricefreeadditionally londres golden launch pier60offersaccesstogreatfinedining sunsetcelebrationsrelaxandunwind summer 000footobservationandfishingareawithbaittackle sensational clear pastures awesome impressive bight wonderful andtheview livemusic entertainmentandoutstandingwhitesandybeaches angle nighttime theeveningsunsetsaretreatedroyallywithafestivecrowdandartistsatclearwaterbeachspier60thepier60festivalvisitorscelebrateeachuniquegulfofmexicosunsetasafunandgrandoccasionthisstreetfestivalfeaturesartists beachbars asthesunsetshereareasuperwaytoendyourdayeverydayatclearwaterbeachitisacelebration cotswold fujifilm with20to24feathersthewingsarelongandbroad orange billscharacterisedbytheattachmentofahugegularpouchtheslenderramiofthelowerbillandtheflexibletonguemusclesformthepouchintoabasketforcatchingfishand photography bpleasefeelfreetocheckoutmyahrefhttpwwwfacebookcompagespickinimagesphotography141658385923405relnofollowfacebook suitablyshapedforsoaringflight atupto15kg33lb car sometimes 106cm42inlong cathedral pauls skyline marina people interestingness edifice andhavetheunusuallylargenumberof30to35secondaryflightfeathersthesmallestspeciesisthebrownpelican view wise o2 terminallyhooked rainwatertheyhavealongneckandshortlegswithlargefeetalthoughtheyappearbulkytheyarerelativelylightbecauseofairpocketsintheskeletonandbeneaththeskinsothattheyfloathighinthewater6thetailisshortandsquare icon paulsthames andcanhaveawingspanofaslittleas183m6ftthelargestisbelievedtobethedalmatian cascaded zoom s6500fd finepix bird travel motorway afollowmeonahrefhttpstwittercomneil1523relnofollowtwitteraoraddmeasaflickrahrefhttpwwwflickrcompeopleneil1523searchpickinimagescontactabpelicansareverylargebirdswithverylong smallindividualsofwhichcanbeaslittleas275kg6lb withamaximumwingspanof3mnearly10fttheaustralianpelicanhasthelongestbillofanybird milky white s6000fd 183cm72inlong l structure flickrdiamond melody m4 my shore specland superaplus trees reedy superhero ray dome morris dock tide trust wharf 350 whitby airport part peak xo harding motif pelican coast national challenge supershot european 2010 moon ii framing katharine diamondclassphotographer global victoria promenade saariysqualitypictures boats mode video airfield bigmomma flowergreensummerspringberkshirereachingforthelight twilight tourist blueribbonwinner unchained birthday virgiliocompany herowinner nightshot tiger cloud flower show challengeyouwinner bravo 600d united theoriginalgoldseal district lady panoramafotográfico waltham plane friendly challenges geotagged windmill dslr cars specnature wide moth a3b anawesomeshot aplusphoto moonphase arquitectura game canary wales yourock magicdonkey pier shot congrats esplanade hosehill challengeyou storybookwinner londonist factory hardingmorris niel rush millenium fotocompetitionbronze europe motifunam

Pairs: 9 images,london by,london london,neil london,pickinimages by,neil by,night by,photos london,nightime by,pickinimages london,pickin london,night

Users: Pickin Images 50


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.