abstract america art brasil brazil bresil building chicago company concrete construction cruz design fabric fe fondodepantalla fondos fondosdepantalla grain illinois industrial material model nordeste papeis papeisdeparede papel papeldeparede parede pattern pernambuco recife rodrigo rodrigocruz rodrigovalença rvc rvc77 structure summer urban valença verano verão wallpaper wallpapers

material    Flickr Hive Mind (more)  Preferences  Get a free ride from Uber (and I will get one too, thanks)
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Advanced 
 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind. If you log into Flickr you will see your private photos and larger thumbnails. Where do these thumbnails come from? How are the photos licensed?
Blaqk Audio || Bowery Ballroom, NYC 05.22.16 (ACSantos) Tags: nyc ny newyork concert nikon tour unitedstates livemusic material boweryballroom electronic daveyhavok musicphotography jadepuget blaqkaudio anasantosphotography acsantosphotography
bauma 2016 (Neuwieser) Tags: road building mobile truck munich mnchen construction power expo crane engine machine dump rail fair mining equipment machinery vehicles roller material shovel messe trade bulldozer grue digger excavator schiene raupe crawler engin bagger 2016 planierraupe dumper baumaschinen baufahrzeuge walze 870 automotrice drague manchette bauma autokran sennebogen mobilkran muldenkipper baugerte raupenbagger excavateur excavatrice bergbaumaschinen baustoffmaschinen 870e
Clothing in Sweden (dungodung) Tags: history museum clothing sweden stockholm exhibit material sverige cloth stokholm materials estocolmo historymuseum museumexhibit stermalm historiskamuseet statenshistoriskamuseum clothingmaterial stockholmsinnerstad swedishhistorymuseum
2015_Mjus_1222 (emzepe) Tags: playground yard garden construction lawn storage works material utca 37 otthon tavasz lom udvar kert 2015 mjus jtsztr ptkezs f szk hdmezvsrhely gyep bercsnyi nlunk rendetlensg anyag munklatok trols
Arbeit 4 (Harald Reichmann) Tags: symbol kunst kreuz brett r material holz jagd zitat verband objekt stck schneidbrett arbeit4
White Ribbon (ONE by one) Tags: white ribbons material ribbon supplies 12cm
DSC_5789 [ps] - Shifting Strands (Anyhoo) Tags: uk shadow red england abstract green london chair chelsea furniture stripes stripe multicoloured fabric strip shade slats material stripey cloth multicolored multicolor multicolour stripy rhs slat royalhorticulturalsociety chelseaflowershow oldroyalnavalcollege anyhoo rhschelseaflowershow rhschelsea photobyanyhoo
quarry outdoors on mountain (Mimadeo) Tags: road mountain industry nature rock stone landscape construction industrial outdoor mining limestone mineral environment material geology quarry extraction excavation
barbara medo oltmans niekerk sample denim colour flow (barbaramedo) Tags: colour detail texture geometric colors fashion closeup flow effects photography design pattern cut interior details style company textures textile barbara fabric sample laser designs denim layers material concept trend textiles conceptual visual effect samples materials styling fabrics medo 2016 sinera forecasting niekerk oltmans wwwbarbaramedocom wwwoltmansvanniekerknl
2014 04 23 035 Newbury and Crookham GC (Mark Baker, photoboxgallery.com/markbaker) Tags: uk blue england bird english nature birds woodland golf photo spring europe european tit baker nest britain mark wildlife united great kingdom course photograph gathering gb april british material berkshire newbury materials collecting nesting 2014 crookham picsmark
Architecture technical, toilet (Appletvn1) Tags: wood house building brick home architecture tile concrete bathroom spain construction industrial panel plumbing insulation plan plate toilet professional wc sanitary technical blueprint electricity layer bathtub material powerline flooring waterpipe homeimprovement plywood crosssection 3drendering tapemeasure plasterboard homerenovation homeinterior subflooring builtstructure constructionframe
Rendl Rossy Lamp  Detail-02 (Toni Fresnedo) Tags: lamp 3d material 3ds 3dmodel 3dsmax rendl maxwellrender fresnedo tonifresnedo
Relational Structures/Notes #3 (Russell Moreton) Tags: colour building collage effects design place interior space drawings objects surface architectural research imagination material paths fieldwork process making movements wayfaring speculative relations dwelling scaffolds exploratory contingent enactments meshworks spatialpractices russellmoreton reanimatingthought intravention productiveengagements photographyspacespatialturn
SILOS124 (Set and Centered) Tags: santa street railroad urban chicago abandoned scale america john concrete graffiti illinois model industrial side elevator grain s structure company prototype ave metcalf and sw silos material ho fe topeka avenue 187 damen relics reference consulting engineers urbex atchinson atsf robey explorations
WINCH MACHINERY (Set and Centered) Tags: santa street railroad urban chicago abandoned scale america john concrete graffiti illinois model industrial side elevator grain s structure company prototype ave metcalf and sw silos material ho fe topeka avenue 187 damen relics reference consulting engineers urbex atchinson atsf robey explorations
SILOS105 (Set and Centered) Tags: santa street railroad urban chicago abandoned scale america john concrete graffiti illinois model industrial side elevator grain s structure company prototype ave metcalf and sw silos material ho fe topeka avenue 187 damen relics reference consulting engineers urbex atchinson atsf robey explorations
WALKWAYS-N VIEW (Set and Centered) Tags: santa street railroad urban chicago abandoned scale america john concrete graffiti illinois model industrial side elevator grain s structure company prototype ave metcalf and sw silos material ho fe topeka avenue 187 damen relics reference consulting engineers urbex atchinson atsf robey explorations
Cotton paris sarong (Della Ong) Tags: beach indonesia singapore little handmade culture material sarong batik nonya littlenyonya
San Antonio Express News building (elnina999) Tags: old city urban abstract detail building brick art texture motif stone wall closeup architecture facade vintage concrete design carved construction ancient sandstone pattern exterior artistic antique background grunge border columns cement masonry perspective style surface structure dirty frame material aged rough ornate pillars ornamental decor railings built stucco moldings balusters corbels plasterornamentation romanionic millworkexamplesintheoldartscraftserahomes mansorydetails decorativeromandoric archmouldingsandwoodcarvingsornamentalcapitalsincludingromancorinthian greekerechtheumandmanymoreauthenticantiquehistoricalhousesandbuildingsineuropeandarchitecturalrevivalsintheus
Emily Morgan Hotel (elnina999) Tags: old city urban abstract detail building brick art texture motif stone wall closeup architecture facade vintage concrete design carved construction ancient sandstone pattern exterior artistic antique background grunge border columns cement masonry perspective style surface structure dirty frame material aged rough ornate pillars ornamental decor railings built stucco moldings balusters corbels plasterornamentation romanionic millworkexamplesintheoldartscraftserahomes mansorydetails decorativeromandoric archmouldingsandwoodcarvingsornamentalcapitalsincludingromancorinthian greekerechtheumandmanymoreauthenticantiquehistoricalhousesandbuildingsineuropeandarchitecturalrevivalsintheus
Mustafa's Store Little India 1 (stanpacz) Tags: singapore material littleindia flickrchallengegroup flickrchallengewinner
 (Emily-Isa Baker) Tags: life stilllife food shells colour digital canon square still flash border eggs backdrop wireless material stacked eggshells
stamp batik process (Della Ong) Tags: indonesia singapore culture stamp textile cooper material wax sarong batik peranakan littlenyonya
IMG_2285 (Chrystelle 2of9) Tags: floral vintage fabric cotton material collectible etsy yardage ticking stipes
Sangue Azul (Rodrigo Valena) Tags: summer brazil praia beach brasil island paradise ile playa atlantic verano tropical vero material plage isla paraiso ilha brasile nordeste atlantico esmeralda noronha sangueazul rodrigovalena
Frost (nag #) Tags: morning autumn winter plants plant flower texture ice field grass weather landscape botanical frozen earth freeze land material wildgrass
Sou Fujimoto (Foto-Ed) Tags: wood urban house tree art nature glass architecture modern forest japanese model open close space future architektur material form jpan eibition
Chegou o inverno! (Rodrigo Valena) Tags: summer wallpaper brazil brasil bresil cruz verano vero material recife wallpapers papel rodrigo papeis pernambuco parede nordeste fondos papeldeparede rvc valena paiva fondodepantalla fondosdepantalla papeisdeparede rodrigocruz rvc77 rodrigovalena
Risoto de camares e rcula com morangos ao balsmico agridoce (Rodrigo Valena) Tags: summer wallpaper brazil brasil bresil cruz verano vero material recife wallpapers papel rodrigo papeis pernambuco parede nordeste fondos duvin papeldeparede rvc valena fondodepantalla fondosdepantalla papeisdeparede rodrigocruz rvc77 rodrigovalena
Tallinn ///// chimneys (.nrq.) Tags: roof color textura tallinn estonia cielo material tejado chimneys chimenea teja
Road to Downtown II (piechotka photography) Tags: usa chicago tower illinois strasse kultur technik architektur material verkehr glas skyscaper hochhaus bruecke herkunft nordamerika
Firefighters, EOD Marines conduct first hazardous material training together (Okinawa Marines) Tags: japan training marine military eod operations okinawa material marines hazardous firefighters marinecorps hazmat explosiveordnancedisposal servicemembers iiimef iiimarineexpeditionaryforce 9thengineersupportbattalion matthewmanning 3rdmarinelogisticsgroup marinecorpsbasecampbutler headquartersandservicebattalion eodcompany mcipac marinecorpsinstallationspacific marinecorpsinstallationspacificfireandemergencyservicesjapan jointhazardousmaterialtraining camphansenjointtrainingfacility homemadeexplosiveingredients
Kodak Retinette 022  - How to use It - Page 4 (TempusVolat) Tags: camera old art film 35mm vintage photography reading book design interesting model scans graphics flickr mr image kodak pages scanner steps picture scan read 1950s howto instrument scanned getty epson instructions material info how booklet guide manual scanning leaflet gw information printed gareth instruction perfection shared 022 retinette pamphlet viewfinder tempus v200 morodo epsonscanner photoscanner epsonperfection chromeage kodakag volat retinette022 mrmorodo garethwonfor tempusvolat
Play with walls. Make the wall really original. Impress (SILK PLASTER) Tags: green wall amazing paint unique interior silk indoor plaster powder cover material walls pure solution wallcovering doityourself finishing impress covering coating fauxpaint silkplasters silkplaster liquidwallpaper readymixbase
Alessandra Leo, Caapa e Telequete em: La Tabaquera (Rodrigo Valena) Tags: summer wallpaper brazil brasil bresil cruz verano vero material recife wallpapers papel alessandra rodrigo papeis pernambuco parede nordeste cassio fondos leao papeldeparede rvc valena bomfim caapa fondodepantalla fondosdepantalla papeisdeparede rodrigocruz rvc77 rodrigovalena latabaquera
Black and White Mask (Cheetah Obscura) Tags: light shadow portrait white selfportrait abstract black me self canon photography photo costume key pattern mask body low suit human 7d material form tight morph fancydress nylon spandex lycra catsuit skintight encasement unitard 2011 formfitting zentai secondskin walkaboutwolf anonymousart robajohnston morphsuit
Colonial walls of Santo Domingo-50 (CUNY Dominican Studies Institute) Tags: dominicanrepublic colonialarchitecture blacks material slaves negros africans zonacolonial murallas africanos repblicadominicana esclavos colonialbuildings blackheritage colonialcity colonialzone colonialhistory arquitecturacolonial monumentoscoloniales colonialmonuments afrolatinos ciudadcolonial edificioscoloniales defensivewalls colonialperiod africanheritage historyofslavery epocacolonial construccionescoloniales ciudaddesantodomingo historiacolonial sitioscoloniales colonialplaces patrimoniomonumental herencianegra herenciaafricana colonialsites lugarescoloniales cityofsantodomingo cunydsi firstblacksoftheamericas primerosnegrosdelasamricas historiadelaesclavitud edificacionesmilitaresdefensivas militarydefensivebuildings patrimoniomaterial colonialconstructions routeofslaves rutasdelosesclavos afrodominicanos afrodominicans monumentalpatrimony
Colonial walls of Santo Domingo-32 (CUNY Dominican Studies Institute) Tags: dominicanrepublic colonialarchitecture blacks material slaves negros africans zonacolonial murallas africanos repblicadominicana esclavos colonialbuildings blackheritage colonialcity colonialzone colonialhistory arquitecturacolonial monumentoscoloniales colonialmonuments afrolatinos ciudadcolonial edificioscoloniales defensivewalls colonialperiod africanheritage historyofslavery epocacolonial construccionescoloniales ciudaddesantodomingo historiacolonial sitioscoloniales colonialplaces patrimoniomonumental herencianegra herenciaafricana colonialsites lugarescoloniales cityofsantodomingo cunydsi firstblacksoftheamericas primerosnegrosdelasamricas historiadelaesclavitud edificacionesmilitaresdefensivas militarydefensivebuildings patrimoniomaterial colonialconstructions routeofslaves rutasdelosesclavos afrodominicanos afrodominicans monumentalpatrimony
02-05-2011-06729.jpg (T vanDam) Tags: strand deutschland meer wasser europa jahreszeiten natur insel steine material rgen landschaft stein zeit frhling kste mecklenburgvorpommern kaparkona
Material World Exhibition 3, Groninger Museum (Marco Bond) Tags: world art netherlands fashion museum design kunst exhibition material mode groninger tentoonstelling
Police Cars, Fire Trucks and Ambulances (This and That From Japan) Tags: cars boys kids print children sewing hobby vehicles fabric material trucks etsy cloth firetrucks ambulances policecars
Cute animals on pink (This and That From Japan) Tags: dog cute animals japan writing japanese sketch artist drawing sewing fabric cotton material etsy cloth import edemberley
Spraying (Dakota Local) Tags: summer cloud mountain tractor toxic field yard rural truck work countryside spring village earth farm country meadow spray works worker material farmer agriculture chemicals far agricultural spraying pesticide
PRE - 016 (Yahoo! Faroeste Caboclo) Tags: arte material base trabalho ferramentas prproduo yahoofaroesteoficial
Ms. Lori (Ordiej) Tags: wood wire dolls handmade ooak glue handpainted material ribbon clothespins
 (Handmade Goodies) Tags: from red brown toy kid education colorful soft child play hand little puppet recycled handmade unique lion story softies gift button material kindergarten tale materials fable handpuppet goodie handmadegoodies
Spa das Artes - Recife 2010 (Rodrigo Valena) Tags: summer wallpaper brazil brasil de pared bresil nu cruz verano vero material recife wallpapers papel rodrigo dibujo fondo papeis pernambuco desenho parede pantalla palhao acre nordeste fondos pelado papeldeparede rvc valena fondodepantalla fondosdepantalla papeisdeparede rodrigocruz spadasartes rvc77 leoresende rodrigovalena
Chaleira (Rodrigo Valena) Tags: summer wallpaper brazil verde green planta brasil de iron bresil cruz verano vero material recife wallpapers papel rodrigo fondo papeis pernambuco parede pantalla nordeste fondos ferro papeldeparede rvc hierro valena chaleira fondodepantalla fondosdepantalla papeisdeparede rodrigocruz rvc77 rodrigovalena
_MG_9250-52 (Tatjanna of T.M Photography) Tags: camera wood shadow abstract black color water grass animal silhouette print model chair colorful pattern mask skin reaching body wheat tiger tights suit human covered zebra second hood material form satin mattress nylon spandex lycra catsuit fitting unitard zentai
A photographical project by photographers Filip Herbst & Rikard Lavitskij (FacesAndThings.com) Tags: fashion foto fotograf sweden herbst picture streetphotography blogger personality iso purse material pocket bild projekt halmstad ficka diptyk nikond700 facebookpage facesandthings filipherbst photoblogg wwwfacesandthingsse wwwfacesandthingscom wwwfacebookcomfacesandthings facesthings rikardlavitskij facesandthingsgteborg innehll lavitskij

page:  1   2   3 
size:  - 

Hivemind: http://flickrhivemind.net/Tags/material Hits: 95542 Pages: 1911



50 material 7 model urban summer concrete 6 verano industrial brazil nordeste rodrigovalença design verão construction brasil structure 5 papeis papel wallpaper chicago valença fondodepantalla parede art building wallpapers company illinois fondosdepantalla fabric pernambuco papeisdeparede pattern bresil papeldeparede recife cruz rvc rvc77 rodrigo fondos rodrigocruz abstract 4 materials elevator damen avenue topeka vintage atchinson sw john metcalf scale consulting and urbex cloth ave 187 atsf railroad architecture grain texture explorations america graffiti wood side street prototype reference fe engineers ho s robey silos abandoned relics santa 3 form wall fashion nature surface brick stone green detail old photography singapore border style etsy closeup shadow handmade colour interior

Pairs: 3 material,singapore 2 littlenyonya,material batik,indonesia material,ribbon batik,culture batik,material littlenyonya,singapore material,sarong handmade,material indonesia,singapore indonesia,sarong

Users: Rodrigo Valença 6 Set and Centered 4 CUNY Dominican Studies Institute elnina999 Della Ong This and That From Japan Emily-Isa Baker Tatjanna of T.M Photography T vanDam SILK PLASTER dungodung Okinawa Marines Russell Moreton emzepe .nrq. Marco Bond nag # FacesAndThings.com Appletvn1 ACSantos Handmade Goodies Harald Reichmann Neuwieser Chrystelle 2of9 ONE by one Cheetah Obscura piechotka photography stanpacz barbaramedo Foto-Ed Anyhoo Ordiej TempusVolat Toni Fresnedo Dakota Local Mimadeo Yahoo! Faroeste Caboclo