architecture art beautiful blue bokeh canon city closeup clouds color colorful colors colour colours flower golden green hdr landscape lens light lines mountain nature nikon nikond90 orange photo photography photos red reflection reflections sea sky snow sony sunset tourism travel trees water wideangle world yellow

colors  Flickr Hive Mind (more)  Preferences 
 Favorites  Groups  Interestingness  Recent  Tags  Text  User  Advanced 
 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind. If you log into Flickr you will see your private photos and larger thumbnails. Where do these thumbnails come from? How are the photos licensed?
Frozen View (Mikko Lagerstedt) Tags: longexposure trees light shadow mist snow cold color detail art colors misty fog mystery night photoshop suomi finland dark lens landscape photography lights frozen photo nikon scenery long exposure frost mood darkness graphic forrest unique horizon fineart stock perspective foggy atmosphere explore mysterious layer layers lonely finnish nikkor sell 70300mm frontpage pinetrees mikko 2010 waterscape resize latyrx d90 nikond90 mikkolagerstedt lagerstedt
Central Park Shadows (Jeffrey Friedkin) Tags: city nyc bridge sky newyork reflection colors skyline architecture clouds outdoors cityscape arch centralpark manhattan newyorker johnlennon dakota thebeatles cityscene newyorkphoto thephotographyblog
Aquabus Granville Island Station (TOTORORO.RORO) Tags: travel light canada tourism water colors ferry skyline vancouver buildings lens living boat rainbow dock bc angle zoom britishcolumbia taxi sony wide wideangle tourist highrise falsecreek service granvilleisland alpha popular visitor f4 hdr granvillebridge attractions aquabus oss nex greatervancouver mirrorless 1018mm nex6 aquabusferries sel1018
Untouched (Mikko Lagerstedt) Tags: blue trees light sunset shadow red snow cold color green art nature colors beautiful field lines rock photoshop suomi finland landscape photography photo nikon colorful shadows view graphic natural image photos unique fineart stock fine perspective smooth award sigma finnish 1020mm sell untouched 2009 mikko 2010 resize latyrx d90 nikond90 mikkolagerstedt lagerstedt
Obsession (zollatiff) Tags: travel sunset sea sky seascape water colors clouds landscape evening twilight nikon scenery ship dusk jetty structures peaceful calm malaysia serene tranquil johor waterscape dangabay zollatif
Happy Fence Friday ( Nana) Tags: light plant green love colors beautiful backlight nikon colorful bokeh creative taiwan theme lovely  hff taiwan i bokehlicious  flickraward d7000 happyfencefriday
A perfect moment in time... (MarcoIE) Tags: world chile travel blue camping panorama patagonia naturaleza mountains color art tourism southamerica sports nature colors beautiful beauty azul clouds digital trekking landscape living frozen highlands amazing colorful searchthebest outdoor hiking gorgeous fineart dramatic happiness bluesky panoramic adventure viajes enjoy beleza concept wilderness conceptual montaa emotions 169 turismo sensations adrenaline helado frio belleza gettyimages montaas highaltitude aventura wideview destinations natgeo nikonstunninggallery anawesomeshot utata:color=black utata:project=uplandscape
Seychelles (green.pit) Tags: ocean africa travel sea vacation sky seascape beach water colors strand landscape ed island sand reisen nikon rocks meer pacific urlaub wave wideangle playa insel afrika seychelles nikkor dslr landschaft plage vacations vr afs gettyimages viajar d800 waterscape 1635 weitwinkel seychellen pazifik 1635mm 14g 2013 nikond800 pitgreenwood
Construction of Ring Road  (yusuf_alioglu) Tags: world new blue red sky mars mountain black colors yellow collage turkey dark photography photo fantastic construction flickr peace photographer mayor earth space trkiye dream panasonic signage barbedwire planet astronomy darkphotography anatolia uzay da planetearth ringroad fantasticphoto dnya astronomi anadolu anewworld tokat gezegen fantasticsky planetmars planetworld municipalsign evreyolu anewseries fantasticpicture picasa3 panasonicdmcls80 yusufaliolu yusufalioglu anewplanet tokatcity unbornart yusufaliogluphotography weloveyoutom imissyoutom photoeditingbyyusufalioglu anewdream constructionofringroad ereyoluinaat belediyebakanl duetotheconstructionofringroadburialisprohibited evreyolualmalar evreyolualmalarnedeniyledefinyapmakyasaktr mydrams fantastikgkyz
Dead tree (Steve-h) Tags: camera wood pink blue autumn trees ireland red dublin orange color colour tree green fall nature colors leaves yellow canon woodland lens dead gold golden log woods colours estate purple control tripod cyan magenta fake wideangle september adobe wireless remote recreation autumnal faked manfrotto lightroom bushypark wideanglelens 2011 steveh adobelightroom manfrottotripod canonef1635mmf28liiusm 190cxpro4 saariysqualitypictures canoneos5dmk2 bestcapturesaoi doublyniceshot tripleniceshot mygearandme mygearandmepremium mygearandmebronze mygearandmesilver mygearandmegold mygearandmeplatinum mygearandmediamond artistoftheyearlevel3 artistoftheyearlevel4 musictomyeyeslevel1 4timesasnice 6timesasnice 5timesasnice 391rc2manfrottolightweighthead gigatproiiwirelessremotecontrol lightroom35 7timesasnice
gadis (Farl) Tags: travel bali colors girl indonesia dance student faith religion performance culture tradition hindu hinduism maiden nusadua tari gadis 2ndcurtainsync pantaimengiat
Golden squiggles (Steve-h) Tags: blue ireland red dublin color colour nature water colors last canon reflections eos gold golden interesting colours maroon days explore seven mk2 5d portobello ripples lightroom postprocessing rathmines steveh adobelightroom colourediting canonef300mmf4lisusmlens explorelastsevendaysinteresting
Cielo 4 (patocorpsa1) Tags: chile road blue santiago winter sky naturaleza white snow color luz nature colors beautiful azul ruta night mi stars photography noche photo nikon long exposure flickr foto time photos nieve young paisaje teen cielo estrellas cajn invierno hermoso nikkor oo amateur region estrella metropolitana vr roca rocas cajon exposicion brillante jovenes joven maipo espaol lightroom brillo tiempo chilean rm aficionados chilenos fotografos strars principiante nikonistas begginer d3000 Astrometrydotnet:status=solved Astrometrydotnet:id=supernova8515
Every wall is a door.. (areyarey) Tags: door old city trip travel india abstract color detail building art history texture tourism motif colors lines stone wall architecture asian design amber ancient mural colorful asia paint pattern arch exterior fort geometry antique decorative background patterns indian traditional famous hipster shapes style mahal palace symmetry retro pot historical ornate decor brass hinduism fortress immortal jaipur cracked rajasthan textured oldfashioned decorated styled areyarey
Oval Sunset (Omar Junior) Tags: blue sunset pordosol red sky orange color colors rio clouds contrast cores geotagged grande high do dynamic pentax d magic laranja portoalegre porto fotos junior nuvens imaging nik alegre omar mapping ist range poa rs ceu tone riograndedosul hdr sul pentaxistd hdri quente tonal mapped exposio lucisart rgs exposicao 17mm highdynamicrangeimaging cameradeourobrasil viveza geo:lat=30052435 geo:lon=51233663
SABANG/the lost sunset (inigolai) Tags: world travel sunset sea beach water colors clouds digital reflections landscape atardecer photography asia paradise philippines silhouettes playa paisaje olympus traveller e3 zuiko siluetas filipinas elmundo reflejos sabang viajar palawan naranjas beachlovers travelphotography sunsetsoftheworld fotografiadigital 1260mm fotosdeviajes earthplanet
Merry Christmas (missgeok) Tags: lighting light art colors architecture composition artwork nikon nightlights colours nightshot artistic sydney creative australia celebrations colourful merrychristmas nationalgeographic projections stmaryscathedral nikond90 brilliantlights
"Mountain Storm" Vietnam~Asia~Sapa~Landscape~Photography~Travel (Dan Ballard Photography) Tags: world pictures travel favorite mist mountain inspiration storm mountains color nature colors beautiful clouds photography hope amazing asia gallery day photographer rice photos pics magic great harvest free best vietnam explore photographs photograph valley land fields prints ballard portfolio agriculture coulds sapa cloudscapes gallary photograpy coloradophotographer danballard danballardphotography danballardphotogarphy terrices riceterrices printforsell
Meribel Mottaret Saulire (wimvandemeerendonk) Tags: blue sunset sky cloud sun mountain snow ski color colour reflection nature colors rock clouds contrast landscape lumix golden rocks colours skiing bright ngc panasonic val hour land frankrijk meribel steep thorens lafrance moguls skislope mountainscape mottaret lestroisvalles saulire steepness topf505074faves
Tired Oscar (missgeok) Tags: lighting light party portrait dog pet cute colors beautiful animal closeup composition oscar mood colours bright artistic expression sydney creative adorable australia sleepy tired precious colourful framing gaze loveable nationalgeographic schnoodle tiring newyearcelebrations colourtones nikond90 untidyhair
Happy COLOR Friday! (VinothChandar) Tags: pink blue red orange india holiday color colour green beach colors marina colours weekend madras chennai tamilnadu vibgyor violed lkight chennaimarinabeach chennaimarina
Agassiz Tulip Festival Panorama (TOTORORO.RORO) Tags: travel blue light red sky people panorama orange mountain snow canada flower tourism colors field lines yellow festival clouds walking lens landscape living landscapes spring bc view zoom britishcolumbia sony lifestyle wideangle row tourist panoramic event tulip bloom alpha curve popular visitor f4 attractions array oss nex takingpicture agassiz snowcappedmountain 180degree mirrorless seabirdisland 1018mm agassiztulipfestival nex6 sel1018
nag-aso (Farl) Tags: travel vacation hot green nature colors spring philippines steam murcia heat onsen sulfur visayas adlaw negros mambukal mambucal negrosoccidental canlaonvolcano
rose (Farl) Tags: blue paris france church window glass colors rose cathedral interior stained notre dame gothicstyle colloidfarlblogspotcom galliccelticrosettecolour
Le pont (Tony N.) Tags: morning bridge sunset mer colors pose soleil long exposure couleurs ngc pont r lever matin longue colorphotoaward
~Orange Cosmos~Explored! (j man.) Tags: life lighting friends light orange flower color macro art texture nature floral colors beautiful closeup lens photography petals illinois cool flickr dof blossom bokeh pov background sony details extreme favorites blurred 11 depthoffield pointofview sp ii views di happybirthday if f2 closeness tamron cosmos comments ld washingtonpark jman af60mm sonya300 mygearandme flickrbronzetrophygroup
Cute Donuts Discovered in Kyoto () Japan (TOTORORO.RORO) Tags: travel food cute tourism colors smile animal japan cat 35mm lens dessert japanese 50mm cafe kyoto afternoon tea f14 sony style f10 tourist sugar chick donuts  sweets  alpha popular visitor doughnuts  attractions   nex tricolored  oyatsu    mirrorless sal50f14 gashi  speedbooster metabones nex5n
Comprer ancora qualcuno?  Marina di Ugento, Puglia (william eos) Tags: desktop city trip travel camping light sea summer vacation italy holiday art tourism water colors canon landscape geotagged photo europa europe italia mare william wallpapers fotografia acqua turismo colori 2009 viaggio salento puglia vacanze citt africano sfondo tema campeggio photografy venditore viaggiare photocard nicepictures bellefoto nicepicture rivadiugento vucumpr marinadiugento finegiornata ef135mmf28withsoftfocus williamp sfondiperdesktop williameos ricordifotografici williamprandi
Bloody Bomb 2 [Explored] (-=[Joms]=-) Tags: macro art water colors bokeh timing hbw hs10 hs11 pnsers bloodybomb
Portland Oregon (Brandon Godfrey) Tags: city blue light red summer urban usa white reflection green water colors skyline night oregon america buildings reflections river portland photography lights us twilight highway scenery colorful downtown cityscape colours unitedstates i5 or unitedstatesofamerica scenic scene freeway hawthornebridge pacificnorthwest pdx lighttrails bluehour colourful portlandor portlandoregon bridgetown westcoast willametteriver hdr highdynamicrange highrises cityskyline interstate5 traffictrails starbursts koincenter burnsidebridge rosecity morrisonbridge cityofroses 2011 wellsfargotower tonemapped brandongodfrey
Light My Way (Explored :) (Manolis Thr) Tags: longexposure sunset red sea sky lighthouse reflection colors clouds greece thessaloniki salonica
the hunt (Mace2000) Tags: wood sunset sky lake reflection nature water colors clouds germany landscape deutschland 350d see wasser shots stones natur wolken karlsruhe landschaft hdr hunt reflektion baggersee badenwrttemberg grtzingen groetzingen mace2000 countryscenery img7846 macelake grtzingersee
Bliss (Edwin van Nuil Photography) Tags: tree colors yellow clouds sunrise germany photography photo foto boom hills fields bliss veld duitsland slopes rapeseed heuvel koolzaad osterodeamharz theharz nedersaksen fujifilmxt1 fujinonlensxf23mmf14r
Lucca - Comics_2014 (Giovanni Meniconi) Tags: boy italy colors girl canon eos italia arte makeup lucca tuscany toscana colori giovanni ragazza ragazzo artisti trucco luccacomics gfv meniconi eos60d giovannimeniconi gruppofotograficoversiliese
Let the Winds of Dawn  be all Soft around you... (-Reji) Tags: ocean morning blue light red orange sunlight water colors beautiful sunshine sunrise dawn seaside twilight waves shine waterfront shades hues kuwait lovely tones goldenhour daybreak refection sn salmiyah
breathless charm (alvin lamucho ) Tags: trees sea orange seascape reflection nature colors beauty silhouette yellow clouds sunrise canon landscape early sand purple middleeast wideangle charm lowtide kuwait depth 1022mm breathless uwa rebelt1i alvinlamucho
Boats II (rschnaible) Tags: ocean sea color portugal colors docks boats harbor boat wooden fishing dock colorful harbour setubal fleet waterfron
Open For Spring (AnyMotion) Tags: flowers plants green primavera floral colors yellow garden leaf spring colours blossom bokeh frankfurt crocus gelb grn blatt blte garten printemps krokus frhling 2014 makroaufnahmen anymotion canoneos5dmarkii 5d2
Other things may change us, but we start and end with family... (.I Travel East.) Tags: flower nature colors nikon dof bokeh bloom cgb itraveleast
Fun colors (Mahmoud Hiepo) Tags: world pictures desktop fiction colors speed canon lens fun eos star book design photo dance dvd very bokeh avatar flash ground manipulation images off iso converse 200 villa these non simple liked merge untitled maintained dazzling 50mmf18 headsets 550d sweetlife2010
I C E. Chefchaouen (Claude Renault Photography) Tags: africa blue portrait colors girl couleurs streetphotography morocco maroc maghreb chefchaouen canoneos moroccan afrique northernafrica travelphotography marocaine afriquedunord clauderenault
Old Shoes! (Honey Pie!) Tags: old colors socks cores shoes stripes converse tenis allstar velho meias chucktaylor tnis listras highsocks kneehighsocks gasto listradas meiaslistradas listrados stripessocks cybershotdscs650 stripeslegs pernaslistradas
ZUMO GOTA A GOTA (J.Rio) Tags: orange naturaleza colors fruit nikon corua paradise flash colores fruta gotas galicia orangejuice splash naranja paraiso coruna zumo macrofotografia 105mmf28 strobist specialpicture nikond700 joserio josriophotography
Robberfly With Its Prey (karthik Nature photography) Tags: macro nature colors animals closeup canon outdoors kill wildlife insects bugs flies robberfly predator hoverfly macrophotography closeupphotography macroworld wildlifephotography macrolife
Colombres - Archivo de Indianos-. ( UfoSp@in  Slow ) Tags: travel art texture colors architecture clouds photoshop spain arquitectura asturias colores ufo textures monumentos 5d monuments vacancy texturas casaazul spanien spagna indianos 2011 colombres photomatrix principadodeasturias ribadedeva archivodeindianos 5dmarkii ufospain
drawing on the water (Lior. L) Tags: light sea reflection water colors marina canon reflections golden israel colorful colours drawing telephoto canondslr telephotolens canon70200f4l hertzelia goldenhours hertzeliabeach canon600d canont3i canonkiss5 marinahertzelia drawingonthewater
~ mistery place ~ (together8) Tags: autumn nature colors landscape spirit ogm magicplace golddragon platinumphoto skytheme diamondclassphotographer flickrdiamond top20greenish nikonflickraward naturescreations novavitanewlife flickrgettyimages together8 thedantecircle
aquarell (Rafakoy) Tags: pictures from test ny newyork color colour colors lines digital pencil pencils photo focus colorful colours with image photos bokeh perspective picture taken images line iso example sample epson aquarell colourfull nikond7000 afsnikkor35mmf18gdx
La Bureba (Ignacio Lizarraga) Tags: primavera colors landscape spain searchthebest paisaje colores nikond50 fields burgos campos springtime outstandingshots zyber labureba abigfave anawesomeshot superaplus aplusphoto
Walking Thru..... (Alfredo11) Tags: street portrait woman flower colors painting nikon pigeons flash nikoncreativelightingsystem

page:  1   2   3 
size:  - 

Hivemind: http://flickrhivemind.net/Tags/colors Hits: 2272894 Pages: 45458



50 colors 14 nature blue color 13 landscape travel clouds 12 light 11 water 10 colours red sky nikon 9 art photography 8 colorful canon sea orange photo beautiful sunset 7 green reflection bokeh lens 6 yellow tourism 5 colour world wideangle snow 4 trees mountain city reflections hdr golden sony architecture flower lines nikond90 photos 3 asia waterscape paisaje popular colourful scenery vacation sunrise flash digital exposure alpha flickr visitor fineart girl creative eos nex colores closeup beach nikkor spring portrait attractions explore lighting twilight tourist naturaleza ocean long pictures night living texture photoshop skyline macro 2011 fields lightroom seascape perspective mirrorless mountains viajar panasonic artistic azul cores land lights blossom ngc nex6 beauty

Pairs: 2 flower,nikon colors,flower bokeh,colors colors,sunset colors,sea colors,nikon 1 hs10,hs11 flash,portrait blue,church bokeh,hs10 greece,lighthouse

Users: TOTORORO.RORO 3 Farl Mikko Lagerstedt Steve-h missgeok rschnaible Manolis Thr areyarey ஐ★ UfoSp@in ★ஐ Slow ﴾͡๏̯͡๏﴿ Brandon Godfrey Rafakoy Jeffrey Friedkin Tony N. patocorpsa1 Dan Ballard Photography Lior. L -Reji VinothChandar Ignacio Lizarraga alvin lamucho © Giovanni Meniconi together8 Omar Junior Edwin van Nuil Photography Honey Pie! AnyMotion inigolai Mahmoud Hiepo wimvandemeerendonk karthik Nature photography MarcoIE zollatiff william eos green.pit j man. yusuf_alioglu Claude Renault Photography .I Travel East. 娜 娜☂Nana Mace2000 J.Rio -=[Joms]=- Alfredo11