2010 arunyenumula bay blue cliff cliffdiving climate coast color currents dive diving divingspot geology hawaii hawaiibeltroad highway11 island january kalae kamaoaahupuaa landsend magma naalehu nature nikon nikond40x ocean rocks scenery sea secluded sky southernmostpointofusa southpoint spectacular strong tides turquoise vacation water waves windy worldofarun yenumula

cliffdiving Flickr Hive Mind Users: WorldofArun difridi I voted for Kodos pinchak haymartxo Nuno Caldeira Remlin Jeff Rose Photography William Mark Sommer alistercoyne nicmifsud... (more)  Preferences 
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Year   Advanced 

Dropbox storage - get 20 GB of Cloud Storage for free.

Flickr Hive Mind is back up! I had to change API keys - Important: if you have authenticated to FHM, you need to re-authenticate the app now for FHM to work properly (go to preferences, log out, log in)

 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/cliffdiving Hits: 4406 Pages: 89 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
A Leap of Faith (Jeff Rose Photography) Tags: world travel blue sea cliff art jeff rose photography nationalpark jump rocks europe faith diving national terre cinqueterre leap manarola cliffdiving cinque jeka itlay cliffdive jeffrose jekaworldphotography liquarian jeffrosephotography kalitharosephotography
"Sit in reverie, and watch the changing color of the waves that break upon the idle seashore of the mind" (WorldofArun) Tags: ocean blue vacation sky cliff color nature sport spectacular island volcano hawaii coast dangerous nikon scenery waves fishermen pacific turquoise dive january windy diving spot hike henry landsend poet planet end tropical strong hi bigisland geology lower climate longfellow tides cliffdiving magma southpoint 2010 wadsworth secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 henrywadsworthlongfellow americanpoet boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad sitinreverieandwatchthechangingcolorofthewavesthatbreakupontheidleseashoreofthemind kamaoaahupuaa arunyenumula
Many say it's Key West, FL but very few know its the South Point, Hawaii - The southernmost point in US of A. (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Living on the edge - Stunt Cows on the cliffs over Compton Bay. (s0ulsurfing) Tags: ocean blue sea sky cliff cloud seascape beach nature water grass weather clouds wow downs landscape fun island bay coast cow interesting funny skies cattle cows natural wind compton patterns extreme wide shoreline wideangle humour cliffs moo explore coastal shore vectis isleofwight coastline hanover 2008 contrails livestock bovidae isle bovine channel grazing cliffdiving englishchannel wight stunt lamanche westwight ungulates 10mm comptonbay sigma1020 dairycow pastural s0ulsurfing aplusphoto welcomeuk
dread air (Remlin) Tags: sea sky cliff storm jump action dive freeze jamaica danny caribbean dread rasta negril cliffdiving guts globalvillage peewees ital anawesomeshot lunarvillage jalalspagesmasterpiecealbum gottaputhimbackontopcuzhesoneofmyalltimefaves
Cliff Diver (Mr. Physics) Tags: vacation blackandwhite bw cliff man male men art sports danger island fly flying action dramatic bodylanguage diving andrew cliffs jamaica fullhouse diver flush straight westend negril cliffdiving westindies 4ofakind msoller 2pair aplusphoto hspoker
April 28th - 365 - Day 11 (JoePhilipson) Tags: cliff beach hawaii book jumping oahu diving joe northshore waimea 365 waimeabay cliffdiving thesource 365days
The Southpoint Cliffs (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Lloviendo hombres (Txanoduna) Tags: bilbao guggenheim redbull cliffdiving lasalve d700 sig120400
Leap of Faith (Explored) (T. Fernandes) Tags: ocean travel sea vacation nikon greece telephoto nikkor cliffdiving nikond90 55mm200mm
"There is nothing more beautiful than a rainbow -  but it takes both rain and sunshine to make one.  If life is to be rounded and many-colored, like a rainbow, both joy and sorrow must come to it" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous rainbow nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae vibgyor 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad thereisnothingmorebeautifulthanarainbowbutittakesbothrainandsunshinetomakeoneiflifeistoberoundedandmanycoloredlikearainbowbothjoyandsorrowmustcometoit kamaoaahupuaa arunyenumula
Dive (Lauren Fowler) Tags: ocean blue film 35mm mexico islands rocks mazatlan cliffdiving
In a high place (Riv) Tags: copenhagen redbull cliffdiving riv
Nusa Ceningan (cteteris) Tags: ocean morning sea bali water indonesia landscape dawn rainbow waves cliffs surge cliffdiving oceanspray nusalembongan nikond700 1424mm28 nusaceningan vision:mountain=078 vision:beach=053
A big island wonder (WorldofArun) Tags: ocean travel blue sea vacation sky cliff hot color beach nature colors sport horizontal spectacular wonder island volcano hawaii islands bay coast dangerous nikon scenery rocks waves pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology climate kona tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue difficulty kalae 808 naalehu 18200mm highway11 southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Orlando Duque (haymartxo) Tags: nikon bilbao redbull cliffdiving saltos orlandoduque nikond7100
Stand up (Nuno Caldeira) Tags: sea cliff lensbaby fisheye cliffdiving cfe waterjump deepwatersolo circularfisheye nunocaldeira
Stand up (Nuno Caldeira) Tags: sea cliff lensbaby dive fisheye cliffdiving stunt backflip cfe circularfisheye nunocaldeira
equipo de recate (haymartxo) Tags: nikon bilbao redbull cliffdiving rescate salvamento nikond7100
Jump! - Cliff Diving (nicmifsud...) Tags: jump redbull challenge cliffdiving minature playmobile nicmifsud flickristi nicmifsudcom
Into the Blue (Matt Champlin) Tags: life blue people cliff lake nature water oregon landscape nationalpark jump jumping action deep cliffs craterlake cliffdiving oneperson plunge jumpingintolakes
Flying Without Wings (Mr. FRANTaStiK) Tags: cliffdiving rockformation sportsphoto norzagaraybulacan saraojeepney francistanphotography bitbitriver
Cliff Diving at Black Rock (Chris Hlady) Tags: sunset hawaii jumping maui cliffdiving blackrock kaanapali
dog daze . (RelicKnife) Tags: summer dog canada mountains green film nature water swimming 35mm jumping jasper alberta horseshoelake cliffdiving
...all she will have is regrets (Stuck in Customs) Tags: austin texas hdr cliffdiving laketravis thatotherpaper
Bella (Cliff Diving) (editha.VAMPIRE GIRL<333) Tags: twilight newmoon cliffdiving kristenstewart bellaswan
Cliff Diver II (Thorsten Nunnemann) Tags: travel italien italy liguria streetphotography fujifilm cliffdiving reise puntachiappa cliffdiver ligurien klippenspringen klippenspringer strasenfotografie vscofilm x100s
Cliff Diving (smullengada) Tags: india silhouette cliffdiving hogenakkalfalls
2822 (bix02138) Tags: bostonma cliffdiving southboston bostonharbor august25 instituteofcontemporaryart seaportdistrict redbullcliffdivingworldseries vision:outdoor=099 vision:sky=0669
 (eddie-g) Tags: boston charlesriver cliffdiving ica
"As long as you don't make waves, ripples, life seems easy. But that's condemning yourself to impotence and death before you are dead" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower jeanne moreau climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae jeannemoreau 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa aslongasyoudontmakewavesrippleslifeseemseasybutthatscondemningyourselftoimpotenceanddeathbeforeyouaredead arunyenumula
"The landscape belongs to the person who looks at it" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast emerson dangerous nikon scenery waves fishermen pacific turquoise dive january windy diving spot hike landsend planet end tropical strong remote hi bigisland geology lower waldo ralph climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae ralphwaldoemerson 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad thelandscapebelongstothepersonwholooksatit kamaoaahupuaa arunyenumula
Black Rock Divers (dthomasd) Tags: ocean vacation sky beach clouds hawaii scenery pentax maui cliffdiving blackrock wg1
Cliff Diving (Stu Templar) Tags: blue sea italy terre cliffdiving cinque vision:outdoor=0906 vision:sky=0847
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: lines silhouette port harbour hamburg hafen cliffdiving rickmerrickmers worldseries linien difridi
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: blackandwhite bw lines silhouette port harbour geometry hamburg schwarzweiss hafen cliffdiving rickmerrickmers worldseries linien difridi
All The Time In The World (William Mark Sommer) Tags: justin summer cliff 120 film water river photography photo crazy high jump rocks folsom hasselblad photograph cliffdiving americanriver hasselblad500cm vision:mountain=0726 vision:outdoor=0964 vision:sky=0765 justinhartsock
Farewell Summer (CAMERON G.) Tags: ocean california summer beach water swimming 35mm waves southern cameron southerncalifornia cliffdiving gardner
hawaii100820_11071 (LDELD) Tags: cliff hawaii lava thebigisland cliffdiving cliffjumping southpoint kalae
Lovely Jumping Ladies (I voted for Kodos) Tags: cliff canada water rock action britishcolumbia dive diving cliffs vernon cliffdiving ellisonpark
Red Bull Cliff Diving World Series 2011, Athens (Alexandros Maragos) Tags: redbull cliffdiving athensgreece lakevouliagmeni
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: silhouette port harbour hamburg hafen cliffdiving rickmerrickmers worldseries difridi
Leap of faith (pinchak) Tags: sunset cliffdiving tobermory ontarioparks tobermoryon
Ellison Park Sequence Three (I voted for Kodos) Tags: canada stitch britishcolumbia dive sequence clone vernon cliffdiving cliffjumping ellisonpark
Salto (pinchak) Tags: sunset cliffdiving tobermory ontarioparks tobermoryon
Skeeter Cliff Diving (BakkoBrats) Tags: pet water animal cat photoshop feline rocks tabby kitty diving cliffdiving skeeter 20061215 oreengeness
divers 03cd (cliff_photo) Tags: sunset sea summer sky swimming rocks dive diving northernireland cliffdiving portstewart highdive cliffdive
Orlando Duque at Malpelo island (PuebloFuerte) Tags: orlando colombia col cliffdiving duque malpelo cliffdive orlandoduque malpeloproject
Piraten in Hamburg? (difridi) Tags: green port harbour hamburg grn hafen cliffdiving rickmerrickmers worldseries difridi
Dubrovnik (alistercoyne) Tags: croatia dubrovnik cliffdiving

page:          1        2        3 
size:     -      

50 cliffdiving 18 cliff 15 sea 13 diving ocean 12 dive blue 11 sky hawaii 10 nature rocks nikon vacation 9 waves island 8 coast water kalae scenery southpoint 7 arunyenumula tides january nikond40x spectacular bay landsend kamaoaahupuaa 2010 yenumula hawaiibeltroad strong climate secluded magma divingspot naalehu highway11 windy currents color southernmostpointofusa turquoise worldofarun geology sport hi tropical 808 deepblue difficulty bigisland 18200mm planet spot volcano hike end pacific dangerous oceancurrent 6 egde remote lower boathoist fishermen redbull hoist sideways 5 cliffs sharp beach jump 4 difridi rickmerrickmers worldseries harbour silhouette hafen sunset summer travel jumping port hamburg action 3 swimming cliffdive 35mm landscape canada film bilbao fisheye terre ontarioparks nikond7100 cfe photography blackandwhite vernon stunt britishcolumbia blackrock tobermory lensbaby orlandoduque lines circularfisheye nationalpark linien aplusphoto art cliffjumping clouds bw nunocaldeira green italy ellisonpark cinque jamaica tobermoryon islands rainbow negril maui downs longfellow vision:outdoor=0906 klippenspringen backflip grün fujifilm grazing shore fun guggenheim storm 365days ralph henrywadsworthlongfellow mountains life male august25 horseshoelake streetphotography emerson flickristi justinhartsock contrails tabby jumpingintolakes bovidae cameron wind oreengeness charlesriver weather portstewart waldo nicmifsudcom 4ofakind colombia redbullcliffdivingworldseries photograph manarola kaanapali man southerncalifornia dairycow orlando athensgreece guts lamanche thereisnothingmorebeautifulthanarainbowbutittakesbothrainandsunshinetomakeoneiflifeistoberoundedandmanycoloredlikearainbowbothjoyandsorrowmustcometoit humour national challenge liquarian kitty geometry dramatic jeffrosephotography lava gardner feline explore oregon henry interesting skies livestock d700 shoreline colors cattle cow americanriver rescate photoshop waimea hasselblad thatotherpaper telephoto india andrew poet highdive malpelo duque freeze norzagaraybulacan jeannemoreau dubrovnik people deepwatersolo jalalspagesmasterpiecealbum wadsworth twilight hanover nicmifsud southern boston funny wow california vision:mountain=0726 justin folsom globalvillage oceanspray 2pair hot coastal puntachiappa vision:sky=0847 sitinreverieandwatchthechangingcolorofthewavesthatbreakupontheidleseashoreofthemind rasta cloud clone waterjump 120 moo instituteofcontemporaryart ralphwaldoemerson kona liguria hasselblad500cm vision:mountain=078 bali jeka lakevouliagmeni bostonharbor francistanphotography gottaputhimbackontopcuzhesoneofmyalltimefaves pastural cows coastline pet 10mm animal photo fly vision:sky=0669 austin jeffrose rose river vision:outdoor=0964 hogenakkalfalls wide horizontal deep nikond700 bellaswan 2008 danny thelandscapebelongstothepersonwholooksatit 20061215 dread jekaworldphotography bostonma croatia cinqueterre men anawesomeshot fullhouse extreme danger dog jasper waimeabay thesource klippenspringer kristenstewart moreau craterlake natural southboston nusalembongan skeeter hspoker sig120400 seaportdistrict greece joe rockformation reise oneperson westindies

Pairs: 6 cliffdiving,redbull 5 cliff,cliffdiving cliffdiving,sea 4 port,rickmerrickmers cliffdiving,hawaii harbour,port cliffdiving,ocean hamburg,port port,worldseries cliffdiving,silhouette cliffdiving,dive

Users: WorldofArun 7 difridi 4 I voted for Kodos pinchak haymartxo Nuno Caldeira Remlin Jeff Rose Photography William Mark Sommer alistercoyne nicmifsud... Mr. FRANTaStiK Matt Champlin RelicKnife CAMERON G. s0ulsurfing LDELD dthomasd eddie-g JoePhilipson cteteris Txanoduna Lauren Fowler bix02138 PuebloFuerte cliff_photo Thorsten Nunnemann Stu Templar Chris Hlady Riv Mr. Physics Alexandros Maragos Stuck in Customs BakkoBrats T. Fernandes smullengada

Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.