2010 arunyenumula bay blue cliff cliffdiving climate coast color currents dive diving divingspot geology hawaii hawaiibeltroad highway11 island january kalae kamaoaahupuaa landsend magma naalehu nature nikon nikond40x ocean rocks scenery sea secluded sky southernmostpointofusa southpoint spectacular strong tides turquoise vacation water waves windy worldofarun yenumula

cliffdiving Flickr Hive Mind Users: WorldofArun difridi I voted for Kodos CAMERON G. bix02138 pinchak Alexandros Maragos Remlin Jeff Rose Photography William Mark Sommer Valerie Santibañez (more)  Preferences 
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Year   Advanced 
Flickr Hive Mind is back up! I had to change API keys - Important: if you have authenticated to FHM, you need to re-authenticate the app now for FHM to work properly (go to preferences, log out, log in)
 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/cliffdiving Hits: 4217 Pages: 85 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
A Leap of Faith (Jeff Rose Photography) Tags: world travel blue sea cliff art jeff rose photography nationalpark jump rocks europe faith diving national terre cinqueterre leap manarola cliffdiving cinque jeka itlay cliffdive jeffrose jekaworldphotography liquarian jeffrosephotography kalitharosephotography
"Sit in reverie, and watch the changing color of the waves that break upon the idle seashore of the mind" (WorldofArun) Tags: ocean blue vacation sky cliff color nature sport spectacular island volcano hawaii coast dangerous nikon scenery waves fishermen pacific turquoise dive january windy diving spot hike henry landsend poet planet end tropical strong hi bigisland geology lower climate longfellow tides cliffdiving magma southpoint 2010 wadsworth secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 henrywadsworthlongfellow americanpoet boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad sitinreverieandwatchthechangingcolorofthewavesthatbreakupontheidleseashoreofthemind kamaoaahupuaa arunyenumula
Many say it's Key West, FL but very few know its the South Point, Hawaii - The southernmost point in US of A. (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Living on the edge - Stunt Cows on the cliffs over Compton Bay. (s0ulsurfing) Tags: ocean blue sea sky cliff cloud seascape beach nature water grass weather clouds wow downs landscape fun island bay coast cow interesting funny skies cattle cows natural wind compton patterns extreme wide shoreline wideangle humour cliffs moo explore coastal shore vectis isleofwight coastline hanover 2008 contrails livestock bovidae isle bovine channel grazing cliffdiving englishchannel wight stunt lamanche westwight ungulates 10mm comptonbay sigma1020 dairycow pastural s0ulsurfing aplusphoto welcomeuk
Cliff Diver (Mr. Physics) Tags: vacation blackandwhite bw cliff man male men art sports danger island fly flying action dramatic bodylanguage diving andrew cliffs jamaica fullhouse diver flush straight westend negril cliffdiving westindies 4ofakind msoller 2pair aplusphoto hspoker
The Southpoint Cliffs (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
"There is nothing more beautiful than a rainbow -  but it takes both rain and sunshine to make one.  If life is to be rounded and many-colored, like a rainbow, both joy and sorrow must come to it" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous rainbow nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae vibgyor 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad thereisnothingmorebeautifulthanarainbowbutittakesbothrainandsunshinetomakeoneiflifeistoberoundedandmanycoloredlikearainbowbothjoyandsorrowmustcometoit kamaoaahupuaa arunyenumula
In a high place (Riv) Tags: copenhagen redbull cliffdiving riv
Cliff Diving (Stu Templar) Tags: blue sea italy terre cliffdiving cinque vision:outdoor=0906 vision:sky=0847
Nusa Ceningan (cteteris) Tags: ocean morning sea bali water indonesia landscape dawn rainbow waves cliffs surge cliffdiving oceanspray nusalembongan nikond700 1424mm28 nusaceningan vision:mountain=078 vision:beach=053
Orlando Duque at Malpelo island (PuebloFuerte) Tags: orlando colombia col cliffdiving duque malpelo cliffdive orlandoduque malpeloproject
Cliff Diving at Black Rock (Chris Hlady) Tags: sunset hawaii jumping maui cliffdiving blackrock kaanapali
Red Bull Cliff Diving World Series 2011, Athens (Alexandros Maragos) Tags: redbull cliffdiving athensgreece lakevouliagmeni
 (eddie-g) Tags: boston charlesriver cliffdiving ica
"As long as you don't make waves, ripples, life seems easy. But that's condemning yourself to impotence and death before you are dead" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower jeanne moreau climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae jeannemoreau 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa aslongasyoudontmakewavesrippleslifeseemseasybutthatscondemningyourselftoimpotenceanddeathbeforeyouaredead arunyenumula
Dubrovnik (alistercoyne) Tags: croatia dubrovnik cliffdiving
#23 - Cliff Diving (JohnONolan) Tags: spain cliffdiving denia blogtripf1
Cliff Diving (TheOtherKav) Tags: green water cali fun cliffdiving
The odd trees of South Point (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue difficulty kalae 808 naalehu 18200mm highway11 southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Spectacular Quarry Lake on Texada Island (PIERRE LECLERC PHOTO) Tags: summer canada green abandoned water beautiful swimming island britishcolumbia turquoise clean clear sunshinecoast cliffdiving swimminghole texada powellriver quarrylake hiddengem oldquarry pierreleclercphotography heisholtlake
2821 inset a (bix02138) Tags: bostonma cliffdiving southboston bostonharbor august25 instituteofcontemporaryart seaportdistrict redbullcliffdivingworldseries vision:people=099 vision:face=099 vision:outdoor=097
And finally he jumped (Valerie Santibaez) Tags: ocean cliff flying jumping rocks scared cliffdiving
2822 (bix02138) Tags: bostonma cliffdiving southboston bostonharbor august25 instituteofcontemporaryart seaportdistrict redbullcliffdivingworldseries vision:outdoor=099 vision:sky=0669
A cliff Jumper's delight (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
dread air (Remlin) Tags: sea sky cliff storm jump action dive freeze jamaica danny caribbean dread rasta negril cliffdiving guts globalvillage peewees ital anawesomeshot lunarvillage jalalspagesmasterpiecealbum gottaputhimbackontopcuzhesoneofmyalltimefaves
April 28th - 365 - Day 11 (JoePhilipson) Tags: cliff beach hawaii book jumping oahu diving joe northshore waimea 365 waimeabay cliffdiving thesource 365days
Dive (Lauren Fowler) Tags: ocean blue film 35mm mexico islands rocks mazatlan cliffdiving
A big island wonder (WorldofArun) Tags: ocean travel blue sea vacation sky cliff hot color beach nature colors sport horizontal spectacular wonder island volcano hawaii islands bay coast dangerous nikon scenery rocks waves pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology climate kona tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue difficulty kalae 808 naalehu 18200mm highway11 southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: lines silhouette port harbour hamburg hafen cliffdiving rickmerrickmers worldseries linien difridi
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: blackandwhite bw lines silhouette port harbour geometry hamburg schwarzweiss hafen cliffdiving rickmerrickmers worldseries linien difridi
Farewell Summer (CAMERON G.) Tags: ocean california summer beach water swimming 35mm waves southern cameron southerncalifornia cliffdiving gardner
All The Time In The World (William Mark Sommer) Tags: justin summer cliff 120 film water river photography photo crazy high jump rocks folsom hasselblad photograph cliffdiving americanriver hasselblad500cm vision:mountain=0726 vision:outdoor=0964 vision:sky=0765 justinhartsock
hawaii100820_11071 (LDELD) Tags: cliff hawaii lava thebigisland cliffdiving cliffjumping southpoint kalae
Lovely Jumping Ladies (I voted for Kodos) Tags: cliff canada water rock action britishcolumbia dive diving cliffs vernon cliffdiving ellisonpark
Jump! - Cliff Diving (nicmifsud...) Tags: jump redbull challenge cliffdiving minature playmobile nicmifsud flickristi nicmifsudcom
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: silhouette port harbour hamburg hafen cliffdiving rickmerrickmers worldseries difridi
Leap of faith (pinchak) Tags: sunset cliffdiving tobermory ontarioparks tobermoryon
Into the Blue (Matt Champlin) Tags: life blue people cliff lake nature water oregon landscape nationalpark jump jumping action deep cliffs craterlake cliffdiving oneperson plunge jumpingintolakes
Ellison Park Sequence Three (I voted for Kodos) Tags: canada stitch britishcolumbia dive sequence clone vernon cliffdiving cliffjumping ellisonpark
Skeeter Cliff Diving (BakkoBrats) Tags: pet water animal cat photoshop feline rocks tabby kitty diving cliffdiving skeeter 20061215 oreengeness
divers 03cd (cliff_photo) Tags: sunset sea summer sky swimming rocks dive diving northernireland cliffdiving portstewart highdive cliffdive
Salto (pinchak) Tags: sunset cliffdiving tobermory ontarioparks tobermoryon
Piraten in Hamburg? (difridi) Tags: green port harbour hamburg grn hafen cliffdiving rickmerrickmers worldseries difridi
Flying Without Wings (Mr. FRANTaStiK) Tags: cliffdiving rockformation sportsphoto norzagaraybulacan saraojeepney francistanphotography bitbitriver
...all she will have is regrets (Stuck in Customs) Tags: austin texas hdr cliffdiving laketravis thatotherpaper
Bella (Cliff Diving) (editha.VAMPIRE GIRL<333) Tags: twilight newmoon cliffdiving kristenstewart bellaswan
"The landscape belongs to the person who looks at it" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast emerson dangerous nikon scenery waves fishermen pacific turquoise dive january windy diving spot hike landsend planet end tropical strong remote hi bigisland geology lower waldo ralph climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae ralphwaldoemerson 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad thelandscapebelongstothepersonwholooksatit kamaoaahupuaa arunyenumula
Black Rock Divers (dthomasd) Tags: ocean vacation sky beach clouds hawaii scenery pentax maui cliffdiving blackrock wg1
Red Bull Cliff Diving World Series 2011, Athens (Alexandros Maragos) Tags: athens greece redbull cliffdiving vouliagmeni
 (CAMERON G.) Tags: ocean california summer people west film beach water swimming 35mm landscape coast rocks waves cameron southerncalifornia cliffdiving gardner


page:          1        2        3 
size:     -      

50 cliffdiving 19 cliff 16 ocean 15 diving 14 rocks sea blue 13 sky dive hawaii 12 waves island 11 coast nature vacation 10 water kalae scenery southpoint turquoise 9 arunyenumula tides january nikond40x spectacular bay landsend kamaoaahupuaa 2010 yenumula hawaiibeltroad strong climate secluded magma divingspot naalehu highway11 windy currents color nikon southernmostpointofusa worldofarun geology sport hi tropical 808 deepblue difficulty bigisland 18200mm planet spot volcano hike end pacific dangerous oceancurrent 8 remote sideways 7 egde lower boathoist fishermen hoist sharp 6 beach 5 cliffs summer jump 4 difridi swimming rickmerrickmers worldseries harbour hafen sunset landscape redbull jumping port hamburg action 3 cliffdive silhouette britishcolumbia 35mm canada green film fun terre ontarioparks august25 cameron redbullcliffdivingworldseries southerncalifornia photography blackandwhite gardner vernon blackrock people tobermory california instituteofcontemporaryart lines bostonharbor nationalpark bostonma linien aplusphoto art cliffjumping southboston seaportdistrict clouds bw flying travel ellisonpark cinque jamaica tobermoryon islands rainbow negril maui downs longfellow vision:outdoor=0906 grün grazing shore storm 365days ralph henrywadsworthlongfellow life male vision:face=099 emerson flickristi justinhartsock contrails tabby jumpingintolakes bovidae wind oreengeness denia charlesriver weather portstewart waldo nicmifsudcom 4ofakind scared colombia photograph manarola kaanapali man dairycow vision:people=099 orlando athensgreece guts lamanche thereisnothingmorebeautifulthanarainbowbutittakesbothrainandsunshinetomakeoneiflifeistoberoundedandmanycoloredlikearainbowbothjoyandsorrowmustcometoit humour national vision:outdoor=097 challenge liquarian kitty geometry dramatic jeffrosephotography lava feline explore pierreleclercphotography oregon henry hiddengem blogtripf1 interesting skies livestock shoreline colors cattle cow americanriver stunt photoshop waimea hasselblad thatotherpaper andrew poet highdive malpelo duque freeze norzagaraybulacan jeannemoreau jalalspagesmasterpiecealbum dubrovnik wadsworth twilight hanover nicmifsud southern boston funny wow vision:mountain=0726 justin folsom west globalvillage oceanspray 2pair hot coastal vision:sky=0847 oldquarry sitinreverieandwatchthechangingcolorofthewavesthatbreakupontheidleseashoreofthemind rasta cloud clone texada heisholtlake 120 moo orlandoduque ralphwaldoemerson kona hasselblad500cm vision:mountain=078 bali jeka lakevouliagmeni francistanphotography gottaputhimbackontopcuzhesoneofmyalltimefaves pastural cows coastline pet 10mm animal photo fly austin vision:sky=0669 jeffrose vouliagmeni rose river vision:outdoor=0964 wide horizontal deep nikond700 bellaswan 2008 danny thelandscapebelongstothepersonwholooksatit 20061215 dread jekaworldphotography croatia cinqueterre men anawesomeshot fullhouse extreme danger thesource waimeabay kristenstewart craterlake natural moreau nusalembongan skeeter hspoker greece joe rockformation oneperson westindies crazy pentax mexico diver seascape texas dawn nusaceningan bitbitriver ungulates lunarvillage jeanne europe sigma1020 laketravis minature sequence clear

Pairs: 5 cliffdiving,ocean 4 cliff,cliffdiving port,rickmerrickmers cliffdiving,hawaii cliffdiving,water cliffdiving,port cliffdiving,sunset hafen,port harbour,port hamburg,port port,worldseries

Users: WorldofArun 9 difridi 4 I voted for Kodos CAMERON G. bix02138 pinchak Alexandros Maragos Remlin Jeff Rose Photography William Mark Sommer Valerie Santibañez alistercoyne Mr. FRANTaStiK nicmifsud... Matt Champlin JohnONolan s0ulsurfing LDELD dthomasd eddie-g JoePhilipson cteteris Lauren Fowler PuebloFuerte cliff_photo Stu Templar TheOtherKav Chris Hlady Riv Mr. Physics Stuck in Customs PIERRE LECLERC PHOTO BakkoBrats


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.