2010 arunyenumula bay blue cliff cliffdiving climate coast color currents dive diving divingspot geology hawaii hawaiibeltroad highway11 island january kalae kamaoaahupuaa landsend magma naalehu nature nikon nikond40x ocean rocks scenery sea secluded sky southernmostpointofusa southpoint spectacular strong tides turquoise vacation water waves windy worldofarun yenumula

cliffdiving Flickr Hive Mind Users: WorldofArun difridi I voted for Kodos CAMERON G. pinchak Alexandros Maragos balazsgardi Remlin Jeff Rose Photography William Mark Sommer Valerie Santibañez (more)  Preferences 
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Year   Advanced 
 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/cliffdiving Hits: 4193 Pages: 84 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
"Sit in reverie, and watch the changing color of the waves that break upon the idle seashore of the mind" (WorldofArun) Tags: ocean blue vacation sky cliff color nature sport spectacular island volcano hawaii coast dangerous nikon scenery waves fishermen pacific turquoise dive january windy diving spot hike henry landsend poet planet end tropical strong hi bigisland geology lower climate longfellow tides cliffdiving magma southpoint 2010 wadsworth secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 henrywadsworthlongfellow americanpoet boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad sitinreverieandwatchthechangingcolorofthewavesthatbreakupontheidleseashoreofthemind kamaoaahupuaa arunyenumula
A Leap of Faith (Jeff Rose Photography) Tags: world travel blue sea cliff art jeff rose photography nationalpark jump rocks europe faith diving national terre cinqueterre leap manarola cliffdiving cinque jeka itlay cliffdive jeffrose jekaworldphotography liquarian jeffrosephotography kalitharosephotography
dread air (Remlin) Tags: sea sky cliff storm jump action dive freeze jamaica danny caribbean dread rasta negril cliffdiving guts globalvillage peewees ital anawesomeshot lunarvillage jalalspagesmasterpiecealbum gottaputhimbackontopcuzhesoneofmyalltimefaves
Cliff Diver (Mr. Physics) Tags: vacation blackandwhite bw cliff man male men art sports danger island fly flying action dramatic bodylanguage diving andrew cliffs jamaica fullhouse diver flush straight westend negril cliffdiving westindies 4ofakind msoller 2pair aplusphoto hspoker
Living on the edge - Stunt Cows on the cliffs over Compton Bay. (s0ulsurfing) Tags: ocean blue sea sky cliff cloud seascape beach nature water grass weather clouds wow downs landscape fun island bay coast cow interesting funny skies cattle cows natural wind compton patterns extreme wide shoreline wideangle humour cliffs moo explore coastal shore vectis isleofwight coastline hanover 2008 contrails livestock bovidae isle bovine channel grazing cliffdiving englishchannel wight stunt lamanche westwight ungulates 10mm comptonbay sigma1020 dairycow pastural s0ulsurfing aplusphoto welcomeuk
April 28th - 365 - Day 11 (JoePhilipson) Tags: cliff beach hawaii book jumping oahu diving joe northshore waimea 365 waimeabay cliffdiving thesource 365days
Many say it's Key West, FL but very few know its the South Point, Hawaii - The southernmost point in US of A. (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Free Fallin' (Rachel Porter) Tags: friends fun flying nevada cliffs cliffdiving cliffjumping crazykids adrenalinerush lakemohave
The Southpoint Cliffs (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
In a high place (Riv) Tags: copenhagen redbull cliffdiving riv
Cliff Diving (Stu Templar) Tags: blue sea italy terre cliffdiving cinque vision:outdoor=0906 vision:sky=0847
Nusa Ceningan (cteteris) Tags: ocean morning sea bali water indonesia landscape dawn rainbow waves cliffs surge cliffdiving oceanspray nusalembongan nikond700 1424mm28 nusaceningan vision:mountain=078 vision:beach=053
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: blackandwhite bw lines silhouette port harbour geometry hamburg schwarzweiss hafen cliffdiving rickmerrickmers worldseries linien difridi
Farewell Summer (CAMERON G.) Tags: ocean california summer beach water swimming 35mm waves southern cameron southerncalifornia cliffdiving gardner
hawaii100820_11071 (LDELD) Tags: cliff hawaii lava thebigisland cliffdiving cliffjumping southpoint kalae
All The Time In The World (William Mark Sommer) Tags: justin summer cliff 120 film water river photography photo crazy high jump rocks folsom hasselblad photograph cliffdiving americanriver hasselblad500cm vision:mountain=0726 vision:outdoor=0964 vision:sky=0765 justinhartsock
Into the Blue (Matt Champlin) Tags: life blue people cliff lake nature water oregon landscape nationalpark jump jumping action deep cliffs craterlake cliffdiving oneperson plunge jumpingintolakes
Flying Without Wings (Mr. FRANTaStiK) Tags: cliffdiving rockformation sportsphoto norzagaraybulacan saraojeepney francistanphotography bitbitriver
Orlando Duque at Malpelo island (PuebloFuerte) Tags: orlando colombia col cliffdiving duque malpelo cliffdive orlandoduque malpeloproject
...all she will have is regrets (Stuck in Customs) Tags: austin texas hdr cliffdiving laketravis thatotherpaper
Red Bull Cliff Diving World Series 2011, Athens (Alexandros Maragos) Tags: redbull cliffdiving athensgreece lakevouliagmeni
 (eddie-g) Tags: boston charlesriver cliffdiving ica
"As long as you don't make waves, ripples, life seems easy. But that's condemning yourself to impotence and death before you are dead" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower jeanne moreau climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae jeannemoreau 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa aslongasyoudontmakewavesrippleslifeseemseasybutthatscondemningyourselftoimpotenceanddeathbeforeyouaredead arunyenumula
"The landscape belongs to the person who looks at it" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast emerson dangerous nikon scenery waves fishermen pacific turquoise dive january windy diving spot hike landsend planet end tropical strong remote hi bigisland geology lower waldo ralph climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae ralphwaldoemerson 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad thelandscapebelongstothepersonwholooksatit kamaoaahupuaa arunyenumula
Dubrovnik (alistercoyne) Tags: croatia dubrovnik cliffdiving
GB.USA.12.0053 (balazsgardi) Tags: usa boston massachusetts redbull cliffdiving extremesport balazsgardi garyhunt
#23 - Cliff Diving (JohnONolan) Tags: spain cliffdiving denia blogtripf1
 (CAMERON G.) Tags: ocean california summer people west film beach water swimming 35mm landscape coast rocks waves cameron southerncalifornia cliffdiving gardner
Spectacular Quarry Lake on Texada Island (PIERRE LECLERC PHOTO) Tags: summer canada green abandoned water beautiful swimming island britishcolumbia turquoise clean clear sunshinecoast cliffdiving swimminghole texada powellriver quarrylake hiddengem oldquarry pierreleclercphotography heisholtlake
And finally he jumped (Valerie Santibaez) Tags: ocean cliff flying jumping rocks scared cliffdiving
"There is nothing more beautiful than a rainbow -  but it takes both rain and sunshine to make one.  If life is to be rounded and many-colored, like a rainbow, both joy and sorrow must come to it" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous rainbow nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae vibgyor 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad thereisnothingmorebeautifulthanarainbowbutittakesbothrainandsunshinetomakeoneiflifeistoberoundedandmanycoloredlikearainbowbothjoyandsorrowmustcometoit kamaoaahupuaa arunyenumula
Dive (Lauren Fowler) Tags: ocean blue film 35mm mexico islands rocks mazatlan cliffdiving
A big island wonder (WorldofArun) Tags: ocean travel blue sea vacation sky cliff hot color beach nature colors sport horizontal spectacular wonder island volcano hawaii islands bay coast dangerous nikon scenery rocks waves pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology climate kona tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue difficulty kalae 808 naalehu 18200mm highway11 southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: lines silhouette port harbour hamburg hafen cliffdiving rickmerrickmers worldseries linien difridi
Lovely Jumping Ladies (I voted for Kodos) Tags: cliff canada water rock action britishcolumbia dive diving cliffs vernon cliffdiving ellisonpark
Jump! - Cliff Diving (nicmifsud...) Tags: jump redbull challenge cliffdiving minature playmobile nicmifsud flickristi nicmifsudcom
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: silhouette port harbour hamburg hafen cliffdiving rickmerrickmers worldseries difridi
Leap of faith (pinchak) Tags: sunset cliffdiving tobermory ontarioparks tobermoryon
Skeeter Cliff Diving (BakkoBrats) Tags: pet water animal cat photoshop feline rocks tabby kitty diving cliffdiving skeeter 20061215 oreengeness
Salto (pinchak) Tags: sunset cliffdiving tobermory ontarioparks tobermoryon
Piraten in Hamburg? (difridi) Tags: green port harbour hamburg grn hafen cliffdiving rickmerrickmers worldseries difridi
divers 03cd (cliff_photo) Tags: sunset sea summer sky swimming rocks dive diving northernireland cliffdiving portstewart highdive cliffdive
Ellison Park Sequence Three (I voted for Kodos) Tags: canada stitch britishcolumbia dive sequence clone vernon cliffdiving cliffjumping ellisonpark
Cliff Diving at Black Rock (Chris Hlady) Tags: sunset hawaii jumping maui cliffdiving blackrock kaanapali
Bella (Cliff Diving) (editha.VAMPIRE GIRL<333) Tags: twilight newmoon cliffdiving kristenstewart bellaswan
Black Rock Divers (dthomasd) Tags: ocean vacation sky beach clouds hawaii scenery pentax maui cliffdiving blackrock wg1
Red Bull Cliff Diving World Series 2011, Athens (Alexandros Maragos) Tags: athens greece redbull cliffdiving vouliagmeni
Cliff Diving (smullengada) Tags: india cliffdiving hogenakkalfalls
Cliff Diving (TheOtherKav) Tags: green water cali fun cliffdiving
The odd trees of South Point (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue difficulty kalae 808 naalehu 18200mm highway11 southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula


page:          1        2        3 
size:     -      

50 cliffdiving 18 cliff 15 ocean 14 diving 13 rocks sea blue 12 sky dive hawaii 11 waves island 10 coast water nature vacation 9 kalae scenery southpoint turquoise 8 arunyenumula tides january nikond40x spectacular bay landsend kamaoaahupuaa 2010 yenumula hawaiibeltroad strong climate secluded magma divingspot naalehu highway11 windy currents color nikon southernmostpointofusa worldofarun geology sport hi 808 tropical deepblue difficulty bigisland 18200mm planet spot volcano hike end pacific dangerous oceancurrent 7 remote sideways 6 egde lower boathoist cliffs fishermen hoist sharp beach 5 redbull summer jump 4 swimming difridi rickmerrickmers worldseries harbour hafen sunset landscape jumping port hamburg action 3 fun cliffdive silhouette britishcolumbia 35mm canada cliffjumping flying green film terre ontarioparks cameron southerncalifornia photography blackandwhite gardner vernon blackrock people tobermory boston california lines nationalpark linien aplusphoto art clouds bw travel ellisonpark cinque jamaica tobermoryon islands rainbow negril maui downs longfellow vision:outdoor=0906 grün grazing shore storm 365days ralph henrywadsworthlongfellow life male flickristi emerson justinhartsock contrails tabby jumpingintolakes bovidae wind oreengeness denia charlesriver weather portstewart nicmifsudcom waldo 4ofakind scared colombia photograph manarola kaanapali man dairycow orlando athensgreece lamanche guts thereisnothingmorebeautifulthanarainbowbutittakesbothrainandsunshinetomakeoneiflifeistoberoundedandmanycoloredlikearainbowbothjoyandsorrowmustcometoit humour national challenge liquarian kitty geometry dramatic adrenalinerush jeffrosephotography lava feline explore pierreleclercphotography oregon henry hiddengem blogtripf1 interesting skies livestock shoreline colors cattle cow americanriver stunt photoshop waimea hasselblad thatotherpaper balazsgardi india andrew poet highdive malpelo lakemohave duque freeze norzagaraybulacan jeannemoreau dubrovnik wadsworth jalalspagesmasterpiecealbum twilight hanover nicmifsud southern funny wow vision:mountain=0726 justin folsom west globalvillage garyhunt extremesport oceanspray 2pair hot coastal vision:sky=0847 oldquarry sitinreverieandwatchthechangingcolorofthewavesthatbreakupontheidleseashoreofthemind rasta cloud clone texada heisholtlake 120 moo orlandoduque kona ralphwaldoemerson hasselblad500cm vision:mountain=078 bali jeka lakevouliagmeni francistanphotography pastural gottaputhimbackontopcuzhesoneofmyalltimefaves crazykids cows coastline pet 10mm animal photo fly austin jeffrose vouliagmeni rose river vision:outdoor=0964 hogenakkalfalls wide horizontal deep nikond700 bellaswan 2008 danny thelandscapebelongstothepersonwholooksatit 20061215 dread jekaworldphotography croatia cinqueterre men anawesomeshot fullhouse extreme danger waimeabay thesource kristenstewart moreau craterlake natural nusalembongan skeeter hspoker greece joe rockformation oneperson westindies crazy pentax mexico diver seascape texas dawn nusaceningan bitbitriver ungulates jeanne lunarvillage europe sigma1020 minature laketravis sequence

Pairs: 5 cliffdiving,ocean cliffdiving,redbull 4 cliff,cliffdiving port,rickmerrickmers cliffdiving,hawaii cliffdiving,water cliffdiving,port cliffdiving,sunset hafen,port harbour,port hamburg,port

Users: WorldofArun 8 difridi 4 I voted for Kodos CAMERON G. pinchak Alexandros Maragos balazsgardi Remlin Jeff Rose Photography William Mark Sommer Valerie Santibañez alistercoyne nicmifsud... Mr. FRANTaStiK Matt Champlin JohnONolan s0ulsurfing LDELD dthomasd eddie-g JoePhilipson cteteris Rachel Porter Lauren Fowler PuebloFuerte cliff_photo Stu Templar TheOtherKav Chris Hlady Riv Mr. Physics Stuck in Customs PIERRE LECLERC PHOTO BakkoBrats smullengada


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.