2010 arunyenumula bay blue cliff cliffdiving climate coast color currents dive diving divingspot geology hawaii hawaiibeltroad highway11 island january kalae kamaoaahupuaa landsend magma naalehu nature nikon nikond40x ocean rocks scenery sea secluded sky southernmostpointofusa southpoint spectacular strong tides turquoise vacation water waves windy worldofarun yenumula

cliffdiving Flickr Hive Mind Users: WorldofArun difridi I voted for Kodos bix02138 pinchak haymartxo Nuno Caldeira Remlin Jeff Rose Photography William Mark Sommer alistercoyne (more)  Preferences  Add to Flipboard
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Year   Advanced 

Welcome to Flickr Hive Mind, almost certainly the best photo search engine on the web. Returning logged in users may need to re-authenticate for FHM to work properly (go to preferences, log out, log in)

Dropbox storage - get 20 GB of Cloud Storage for free.

 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/cliffdiving Hits: 4413 Pages: 89 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
A Leap of Faith (Jeff Rose Photography) Tags: world travel blue sea cliff art jeff rose photography nationalpark jump rocks europe faith diving national terre cinqueterre leap manarola cliffdiving cinque jeka itlay cliffdive jeffrose jekaworldphotography liquarian jeffrosephotography kalitharosephotography
"Sit in reverie, and watch the changing color of the waves that break upon the idle seashore of the mind" (WorldofArun) Tags: ocean blue vacation sky cliff color nature sport spectacular island volcano hawaii coast dangerous nikon scenery waves fishermen pacific turquoise dive january windy diving spot hike henry landsend poet planet end tropical strong hi bigisland geology lower climate longfellow tides cliffdiving magma southpoint 2010 wadsworth secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 henrywadsworthlongfellow americanpoet boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad sitinreverieandwatchthechangingcolorofthewavesthatbreakupontheidleseashoreofthemind kamaoaahupuaa arunyenumula
Many say it's Key West, FL but very few know its the South Point, Hawaii - The southernmost point in US of A. (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Living on the edge - Stunt Cows on the cliffs over Compton Bay. (s0ulsurfing) Tags: ocean blue sea sky cliff cloud seascape beach nature water grass weather clouds wow downs landscape fun island bay coast cow interesting funny skies cattle cows natural wind compton patterns extreme wide shoreline wideangle humour cliffs moo explore coastal shore vectis isleofwight coastline hanover 2008 contrails livestock bovidae isle bovine channel grazing cliffdiving englishchannel wight stunt lamanche westwight ungulates 10mm comptonbay sigma1020 dairycow pastural s0ulsurfing aplusphoto welcomeuk
dread air (Remlin) Tags: sea sky cliff storm jump action dive freeze jamaica danny caribbean dread rasta negril cliffdiving guts globalvillage peewees ital anawesomeshot lunarvillage jalalspagesmasterpiecealbum gottaputhimbackontopcuzhesoneofmyalltimefaves
Cliff Diver (Mr. Physics) Tags: vacation blackandwhite bw cliff man male men art sports danger island fly flying action dramatic bodylanguage diving andrew cliffs jamaica fullhouse diver flush straight westend negril cliffdiving westindies 4ofakind msoller 2pair aplusphoto hspoker
Lloviendo hombres (Txanoduna) Tags: bilbao guggenheim redbull cliffdiving lasalve d700 sig120400
Leap of Faith (Explored) (T. Fernandes) Tags: ocean travel sea vacation nikon greece telephoto nikkor cliffdiving nikond90 55mm200mm
"There is nothing more beautiful than a rainbow -  but it takes both rain and sunshine to make one.  If life is to be rounded and many-colored, like a rainbow, both joy and sorrow must come to it" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous rainbow nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae vibgyor 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad thereisnothingmorebeautifulthanarainbowbutittakesbothrainandsunshinetomakeoneiflifeistoberoundedandmanycoloredlikearainbowbothjoyandsorrowmustcometoit kamaoaahupuaa arunyenumula
In a high place (Riv) Tags: copenhagen redbull cliffdiving riv
Nusa Ceningan (cteteris) Tags: ocean morning sea bali water indonesia landscape dawn rainbow waves cliffs surge cliffdiving oceanspray nusalembongan nikond700 1424mm28 nusaceningan vision:mountain=078 vision:beach=053
A big island wonder (WorldofArun) Tags: ocean travel blue sea vacation sky cliff hot color beach nature colors sport horizontal spectacular wonder island volcano hawaii islands bay coast dangerous nikon scenery rocks waves pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology climate kona tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue difficulty kalae 808 naalehu 18200mm highway11 southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Stand up (Nuno Caldeira) Tags: sea cliff lensbaby fisheye cliffdiving cfe waterjump deepwatersolo circularfisheye nunocaldeira
All The Time In The World (William Mark Sommer) Tags: justin summer cliff 120 film water river photography photo crazy high jump rocks folsom hasselblad photograph cliffdiving americanriver hasselblad500cm vision:mountain=0726 vision:outdoor=0964 vision:sky=0765 justinhartsock
Farewell Summer (CAMERON G.) Tags: ocean california summer beach water swimming 35mm waves southern cameron southerncalifornia cliffdiving gardner
Stand up (Nuno Caldeira) Tags: sea cliff lensbaby dive fisheye cliffdiving stunt backflip cfe circularfisheye nunocaldeira
Orlando Duque (haymartxo) Tags: nikon bilbao redbull cliffdiving saltos orlandoduque nikond7100
hawaii100820_11071 (LDELD) Tags: cliff hawaii lava thebigisland cliffdiving cliffjumping southpoint kalae
Lovely Jumping Ladies (I voted for Kodos) Tags: cliff canada water rock action britishcolumbia dive diving cliffs vernon cliffdiving ellisonpark
Red Bull Cliff Diving World Series 2011, Athens (Alexandros Maragos) Tags: redbull cliffdiving athensgreece lakevouliagmeni
Jump! - Cliff Diving (nicmifsud...) Tags: jump redbull challenge cliffdiving minature playmobile nicmifsud flickristi nicmifsudcom
Cliff Diver II (Thorsten Nunnemann) Tags: travel italien italy liguria streetphotography fujifilm cliffdiving reise puntachiappa cliffdiver ligurien klippenspringen klippenspringer strasenfotografie vscofilm x100s
divers 03cd (cliff_photo) Tags: sunset sea summer sky swimming rocks dive diving northernireland cliffdiving portstewart highdive cliffdive
Orlando Duque at Malpelo island (PuebloFuerte) Tags: orlando colombia col cliffdiving duque malpelo cliffdive orlandoduque malpeloproject
Cliff Diving at Black Rock (Chris Hlady) Tags: sunset hawaii jumping maui cliffdiving blackrock kaanapali
Bella (Cliff Diving) (editha.VAMPIRE GIRL<333) Tags: twilight newmoon cliffdiving kristenstewart bellaswan
Cliff Diving (smullengada) Tags: india silhouette cliffdiving hogenakkalfalls
2822 (bix02138) Tags: bostonma cliffdiving southboston bostonharbor august25 instituteofcontemporaryart seaportdistrict redbullcliffdivingworldseries vision:outdoor=099 vision:sky=0669
 (eddie-g) Tags: boston charlesriver cliffdiving ica
"As long as you don't make waves, ripples, life seems easy. But that's condemning yourself to impotence and death before you are dead" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower jeanne moreau climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae jeannemoreau 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa aslongasyoudontmakewavesrippleslifeseemseasybutthatscondemningyourselftoimpotenceanddeathbeforeyouaredead arunyenumula
"The landscape belongs to the person who looks at it" (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast emerson dangerous nikon scenery waves fishermen pacific turquoise dive january windy diving spot hike landsend planet end tropical strong remote hi bigisland geology lower waldo ralph climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae ralphwaldoemerson 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad thelandscapebelongstothepersonwholooksatit kamaoaahupuaa arunyenumula
April 28th - 365 - Day 11 (JoePhilipson) Tags: cliff beach hawaii book jumping oahu diving joe northshore waimea 365 waimeabay cliffdiving thesource 365days
The Southpoint Cliffs (WorldofArun) Tags: ocean blue sea vacation sky cliff color nature sport spectacular island volcano hawaii bay coast dangerous nikon scenery rocks waves fishermen pacific turquoise dive january windy diving spot hike sharp landsend planet end tropical strong remote hi bigisland geology lower climate tides cliffdiving sideways magma southpoint 2010 secluded currents deepblue hoist difficulty egde kalae 808 naalehu 18200mm highway11 boathoist southernmostpointofusa nikond40x yenumula divingspot worldofarun oceancurrent hawaiibeltroad kamaoaahupuaa arunyenumula
Dive (Lauren Fowler) Tags: ocean blue film 35mm mexico islands rocks mazatlan cliffdiving
Cliff Diving (Stu Templar) Tags: blue sea italy terre cliffdiving cinque vision:outdoor=0906 vision:sky=0847
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: lines silhouette port harbour hamburg hafen cliffdiving rickmerrickmers worldseries linien difridi
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: blackandwhite bw lines silhouette port harbour geometry hamburg schwarzweiss hafen cliffdiving rickmerrickmers worldseries linien difridi
Cliff Diving World Series 2009 in Hamburg (difridi) Tags: silhouette port harbour hamburg hafen cliffdiving rickmerrickmers worldseries difridi
Leap of faith (pinchak) Tags: sunset cliffdiving tobermory ontarioparks tobermoryon
Ellison Park Sequence Three (I voted for Kodos) Tags: canada stitch britishcolumbia dive sequence clone vernon cliffdiving cliffjumping ellisonpark
Salto (pinchak) Tags: sunset cliffdiving tobermory ontarioparks tobermoryon
Into the Blue (Matt Champlin) Tags: life blue people cliff lake nature water oregon landscape nationalpark jump jumping action deep cliffs craterlake cliffdiving oneperson plunge jumpingintolakes
Skeeter Cliff Diving (BakkoBrats) Tags: pet water animal cat photoshop feline rocks tabby kitty diving cliffdiving skeeter 20061215 oreengeness
Flying Without Wings (Mr. FRANTaStiK) Tags: cliffdiving rockformation sportsphoto norzagaraybulacan saraojeepney francistanphotography bitbitriver
Piraten in Hamburg? (difridi) Tags: green port harbour hamburg grn hafen cliffdiving rickmerrickmers worldseries difridi
equipo de recate (haymartxo) Tags: nikon bilbao redbull cliffdiving rescate salvamento nikond7100
dog daze . (RelicKnife) Tags: summer dog canada mountains green film nature water swimming 35mm jumping jasper alberta horseshoelake cliffdiving
...all she will have is regrets (Stuck in Customs) Tags: austin texas hdr cliffdiving laketravis thatotherpaper
2730 (bix02138) Tags: athletes bostonma cliffdiving southboston bostonharbor jocks august25 instituteofcontemporaryart seaportdistrict redbullcliffdivingworldseries vision:outdoor=099 vision:sky=0926
Dubrovnik (alistercoyne) Tags: croatia dubrovnik cliffdiving

page:          1        2        3 
size:     -      



50 cliffdiving 18 cliff 15 sea 13 diving 12 ocean dive blue 10 sky nature rocks nikon hawaii 9 vacation waves island 8 coast water kalae southpoint 7 january bay landsend kamaoaahupuaa strong climate secluded divingspot highway11 windy scenery currents color southernmostpointofusa hi difficulty 18200mm spot hike end dangerous arunyenumula tides nikond40x spectacular 2010 yenumula hawaiibeltroad magma naalehu turquoise worldofarun geology sport 808 tropical deepblue bigisland planet volcano pacific oceancurrent 6 remote redbull hoist egde lower boathoist fishermen sideways 5 jump cliffs sharp 4 difridi worldseries harbour silhouette hafen summer port hamburg rickmerrickmers sunset travel beach jumping action 3 swimming canada film bilbao cliffdive 35mm landscape august25 redbullcliffdivingworldseries stunt bostonma linien aplusphoto art cliffjumping green ellisonpark jamaica islands rainbow negril vision:outdoor=099 fisheye terre ontarioparks nikond7100 cfe photography blackandwhite vernon britishcolumbia tobermory lensbaby orlandoduque instituteofcontemporaryart lines circularfisheye bostonharbor nationalpark southboston seaportdistrict bw nunocaldeira italy cinque tobermoryon vision:outdoor=0906 grün fujifilm shore storm 365days ralph henrywadsworthlongfellow mountains life horseshoelake emerson jumpingintolakes wind nicmifsudcom 4ofakind photograph manarola kaanapali man southerncalifornia dairycow guts lamanche national challenge liquarian gardner feline explore interesting d700 shoreline cattle cow thatotherpaper andrew poet malpelo duque jeannemoreau dubrovnik people jalalspagesmasterpiecealbum wadsworth twilight southern wow california vision:mountain=0726 justin folsom globalvillage coastal vision:sky=0847 clone waterjump 120 moo liguria hasselblad500cm vision:mountain=078 bali pastural pet animal photo fly rose river horizontal deep nikond700 dread men fullhouse extreme danger jasper waimeabay skeeter hspoker sig120400 greece reise oneperson alberta mexico nusaceningan ungulates jeanne lunarvillage saltos europe flying laketravis sequence saraojeepney surge salvamento lake peewees bovine 1424mm28 copenhagen ica caribbean channel plunge cat oahu sports riv italien westwight msoller northernireland lasalve vision:beach=053 wonder rock vision:sky=0765 itlay s0ulsurfing aslongasyoudontmakewavesrippleslifeseemseasybutthatscondemningyourselftoimpotenceanddeathbeforeyouaredead 55mm200mm vscofilm isleofwight newmoon maui book jeff compton downs longfellow klippenspringen backflip grazing fun guggenheim male streetphotography flickristi justinhartsock contrails tabby bovidae cameron oreengeness charlesriver weather portstewart waldo colombia orlando athensgreece thereisnothingmorebeautifulthanarainbowbutittakesbothrainandsunshinetomakeoneiflifeistoberoundedandmanycoloredlikearainbowbothjoyandsorrowmustcometoit humour kitty geometry dramatic jeffrosephotography lava oregon henry skies livestock colors americanriver rescate photoshop waimea hasselblad telephoto jocks india blackrock highdive freeze norzagaraybulacan

Pairs: 6 cliffdiving,redbull 5 cliff,cliffdiving cliffdiving,sea 4 port,rickmerrickmers harbour,port hamburg,port port,worldseries cliffdiving,silhouette cliffdiving,dive cliffdiving,port cliffdiving,sunset

Users: WorldofArun 7 difridi 4 I voted for Kodos bix02138 pinchak haymartxo Nuno Caldeira Remlin Jeff Rose Photography William Mark Sommer alistercoyne Mr. FRANTaStiK nicmifsud... Matt Champlin RelicKnife CAMERON G. s0ulsurfing LDELD eddie-g JoePhilipson cteteris Txanoduna Lauren Fowler PuebloFuerte cliff_photo Thorsten Nunnemann Stu Templar Chris Hlady Riv Mr. Physics Alexandros Maragos Stuck in Customs BakkoBrats T. Fernandes smullengada


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.