architecture blue bosphorus cami camii color estambul hdr islam islamic istanbul landscape light mezquita minare minaret minarets mosque muslim night nikon osmanlı ottomanstyle red religion sea sky sultanahmet sunset travel trip turchia turkei turkey turkiet turkije turkiye turkki turquia turquie tyrkiet tyrkland törökország türkei türkiye

cami Flickr Hive Mind Users: Kuzeytac blame_the_monkey belthelem Andrew Litsch SBA73 Nejdet Duzen Manikiií fotografías ✿ yonca60 ssj_george Sir Francis Canker Photography © Celalettin Güneş (more)  Preferences 
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Advanced 

The Flickr API has been buggy over the past few days, some searches are returning no results. Sorry for the troubles! -Nathan


 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/cami Hits: 37411 Pages: 749 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
Abu Dhabi, Sheikh Zayed Grand Mosque -        (Sir Francis Canker Photography ) Tags: longexposure travel blue panorama reflection art tourism monument skyline architecture night court lights twilight asia dubai artistic dusk muslim islam religion uae picture middleeast arches landmark courtyard visit icon mosque tourist best arabic emirates abudhabi hour dome oil nocturna mezquita arabian visiting cami peninsula ever nuit investment unitedarabemirates notte impressive icono gcc islamic crude touristic persiangulf moschea mosque lucena emea ayatollah coran arenzano petrodollar     sirfranciscankerjones sheikhzayedmosque  tz10 zs7  pacocabezalopez
Istanblue Haze (Kuzeytac) Tags: blue sea color colour tower silhouette night turkey landscape haze cityscape purple minaret trkiye turkiye istanbul palace scape cami topkapi siluet deniz leyla sultanahmet topkap estambul bosphorous boaz saray gece lsi ayasofya minare kule sarayburnu supershot canon70300isusm kabata iskelesi canoneos400d canoneosdigitalrebelxti anawesomeshot aplusphoto flickrdiamond theunforgettablepictures fbdg kuzeytac 100commentgroup magicunicornverybest
Fabulous Mosque... (Kvan Ni) Tags: costa strand turkey coast seaside riviera place trkiye bank mosque an explore turquie trkorszg trkei shore mezquita seafront residence fabulous cami istanbul seashore istambul turkije sitio spazio moschea turqua mosque tyrkiet camii turchia sahil  turkki turcja beikta mekn moschee  borde turkiet  turkye tyrkia  turkija turecko  mekan  turki turska turcia estanbul   tyrkland turcija  twrci turija fotografkraathanesi turqi tuirc   thebestofday     kefetmek uturuki
Hamidiye camii - The Hamidiye Mosque - istanbul (Bilal K) Tags: turkey muslim islam religion turkiye istanbul mosque explore linda sultan cami hamidiyecamii hamit camii turchia beikta yldz hamidiye abigfave mailciler beiktailesinde barbarosbulvarndayldzsarayyoluzerindedir18851886yllararasndasultaniiabdlhamidtarafndanyaptrlmtrplannnbizzatsultaniiabdlhamidtarafndanyapldsylenmektedirisslemeleridikkatekicigzelliktedirsave tavan18ayaraltndanyaplmsslsferaodas soldaysatavanyalboyatabloluveoksslolanhnkarmahfilibulunmaktadrtekerefeliminaresiilemelerlebezenmitirdrtkalndemirstunzerineoturanveetraf16pencereliolankubbesininsaaklaroymayldzlarlaevrilidirkubbesinin
A Tile Paradise; Sokollu Mehmet Pasha Mosque (HDR) (Kuzeytac) Tags: longexposure travel blue light red color colour building architecture turkey tile geotagged europa europe handmade vibrant trkiye turkiye vivid wideangle istanbul mosque historic trkei ottoman cami geotag hdr leyla rumi mimari bulut turchia lsi eminn eminonu k iznik renk tarihi sarayburnu osmanl renkler turkuaz sigma1020 supershot tarih ini mimarsinan tarihiyarmada turquaz hatai kadrga canoneos400d canoneosdigitalrebelxti ottomanstyle genia kuzeytac turkishfineart 100commentgroup copyrightedallrightsreserved kadrgasokullucamii sokullupasacamii
Sacred Silence - Hagiasofia (HDR) (Kuzeytac) Tags: old travel blue light red sky urban brown moon color colour detail building history texture architecture turkey geotagged gold evening twilight europa europe view antique vibrant minaret postcard trkiye turkiye vivid scene istanbul historic dome nocturna ay cami geotag lunar mavi hdr hagiasofia leyla estambul mimari doku bulut antik tapnak manzara gnbatm turchia lsi ayasofya minare kubbe turkei k krmz renk tarihi renkler alem altn tarih kahverengi detay ehir canon70300isusm tarihiyarmada canoneos400d canoneosdigitalrebelxti kuzeytac copyrightedallrightsreserved
forever yellows skys (Manikii fotografas ) Tags: canon colores nia amarillo lengua cami rocio jugo maniki diamondclassphotographer minimanikiii
Sultan Ahmed And The Sea - (Istanbul, Turkey) (blame_the_monkey) Tags: longexposure travel architecture night turkey minaret istanbul mosque bluehour portfolio bluemosque cami sultanahmet sultanahmed
Fall (Fenanov) Tags: autumn red brown fall nature natural redhead otoo cami redhair kx pentaxkx udec 50mm17 fenanov fenanovfotografas cafrojo
 (ssj_george) Tags: leica sunset red sky orange sun tree nature colors silhouette yellow night clouds plane dark airplane landscape lumix evening airport still movement purple sundown wind tripod cyprus mosque line panasonic sultan tekke 1001nights cami haram hala hum larnaca nighshot superaplus aplusphoto   fz38 fz35 ssjgeorge
Blue Mosque - IstanBlue  (HDR) (Kuzeytac) Tags: blue sky cloud color colour architecture court turkey trkiye turkiye wideangle courtyard istanbul explore cami mavi hdr leyla sultanahmet bulut gkyz lsi sultanahmetcami renk renkler sigma1020 avlu canoneos400d canoneosdigitalrebelxti anawesomeshot genia kuzeytac panoramafotogrfico superstarthebest aqualityonlyclub
The Blue Mosque from Hagia Sophia (lachance) Tags: sunset architecture turkey view istanbul mosque cami hdr byzantine thebluemosque sultanahmedmosque
Serenitat / Serenity (SBA73) Tags: verde green japan forest kyoto camino grove path buddhist buddhism bamboo bosque zen  take nippon  kioto cami bamb kansai nihon jap sagano verd tenryuji bosc  budismo japn budista budisme corriol anawesomeshot colourartaward
Across the bay (maistora) Tags: ocean city bridge blue light sea sky orange history yellow architecture night creek reflections turkey temple lights evening bay glow shine waterfront traffic minaret magic trkiye istanbul mosque historic clear story trkei nighttime temples getty ottoman oriental seafront orient multicultural stories cami legend turkije turquia beyoglu fable mosques minarets 1001 galata goldenhorn tyrkiet turchia pera turkki orta eminonu kulesi bey turkiet tyrkia dibi osmanl tyrkland maistora ysplix theunforgettablepictures ottomanstyle alemdagqualityonlyclub
Sunset on Eminn - Istanbul (belthelem) Tags: trip travel sunset sea sun turkey boat nikon barco d70 trkiye d70s istanbul mosque turquie trkorszg trkei mezquita bec cami turkije turquia anochecer viajar estambul galata goldenhorn tyrkiet camii turchia t100 suleymaniye turkki tirkiye gpc themoulinrouge eminn eminonu turkiet tyrkia clarooscuro cuernodeoro 100faves 10faves imagepoetry tyrkland 25faves ltytrx5 superaplus aplusphoto ltytr1 superhearts a3b hali belthelem oracoob oracosm
Ortakoy Mosque - Istanbul (belthelem) Tags: trip travel bridge blue sea turkey puente nikon d70 trkiye d70s istanbul mosque turquie trkorszg trkei mezquita cami breathtaking turquia bosphorus viajar 1000views marmara estambul virado camii t100 tirkiye ortakoy ortaky buyuk bosforo mecidiye 35faves 25faves ortakoymosque holidaysvacanzeurlaub mecidiyemosque amazingamateur buyukmecidiye mecidiyecamii platinumheartaward a3b world100f ryc4x2 belthelem buyukcamii acfy obq nolodudesyponla
Istanbul: Eyes wide open... (orgutcayli) Tags: bridge sea sky cloud turkey boat interestingness fisherman widescreen wideangle istanbul mosque explore cami kopru deniz sandal bosphorus constantinople bulut bogaz ortakoy gokyuzu constantinopolis bogazkoprusu orgutcayli turkiye orgutcayl
Blue Mosque, ISTANBUL (yonca60) Tags: sunset red turkey istanbul mosque bluemosque cami sultanahmet reddish panoramafotogrfico bestcapturesaoi elitegalleryaoi mygearandme mygearandmepremium mygearandmebronze mygearandmesilver mygearandmegold mygearandmeplatinum mygearandmediamond ringexcellence dblringexcellence tplringexcellence yoncaevren
Abu Dhabi, Sheikh Zayed Grand Mosque -        (Sir Francis Canker Photography ) Tags: longexposure travel blue panorama reflection art tourism monument skyline architecture night court lights twilight asia dubai artistic dusk muslim islam religion uae picture middleeast arches landmark courtyard visit icon mosque tourist best arabic emirates abudhabi hour dome oil nocturna mezquita arabian visiting cami peninsula ever nuit investment unitedarabemirates notte impressive icono gcc islamic crude touristic persiangulf moschea mosque lucena emea ayatollah coran arenzano petrodollar     sirfranciscankerjones sheikhzayedmosque  tz10 zs7  pacocabezalopez
cami (Andrew Litsch) Tags: 35mm nikon florida south andrew 18 cami d40 litsch strobist drewshoots
Graffiti Cat by Berok en Matar (WWW.BEROK.ES) Tags: street light shadow detalle detail art texture luz colors animal ojo graffiti luces calle mural bigotes sombra colores ojos gato felino draw graff cami dibujo mirada morro gat mig gatito mirando profesional mataro colous pintado minino dibujado berok graffitero detallista
Sultan II.Selim Trbesi- Kubbe - Tomb of Sultan II.Selim-Dome (Celalettin Gne) Tags: city urban art history church hat museum turkey nikon handmade mosaic trkiye tomb istanbul mosque turquie trkorszg trkei civilization ottoman cami topkappalace hagiasophia islamic sultanahmet estambul mimari turqua islamicart turchia ayasofya architectur mozaik mezar  kilise tirkiye mze eyupsultan turcja  osmanl ssleme  turki tarih topkapsaray ummah   trbe  medeniyet  etnorafya otomanempire zenaat ottomanstyle    celalettingne 2selim 3murad iiselim padiahtrbeleri 3mehmed wwwgunesgentr wwwgnegentr   klasiksanatlar elsanatalar islamvesanat
Sultan Ahmed And The Sea (Alt 01) - (Istanbul, Turkey) (blame_the_monkey) Tags: travel sunset architecture turkey istanbul bluemosque cami goldenhour sultanahmet sultanahmed goldhour
two moons (ssj_george) Tags: leica sunset sea two sky orange moon beach colors silhouette clouds temple lumix evening twilight purple wind minaret magic religion cyprus windy mosque panasonic moons cami nigh larnaca nighshot   foinikoudes   georgestavrinos   fz38 fz35 ssjgeorge
The Safehouse (Stuck in Customs) Tags: wood travel patagonia sun house lake cold color abandoned argentina argentine field del america lens landscape ushuaia lago photography high nikon republic dynamic stuck outdoor steel empty south shed structure forgotten flare april remote shack safe top100 fuego cami range husk ona 2009 hdr isolated trey corrugated dilapidated settlement customs safehouse tierra hinterland ratcliff ymana stuckincustoms yamana d3x subpolar selknam fagano
Yeni Cami (New Mosque) in Istanbul, Turkey (canbalci) Tags: architecture cami carpet domes eminonu interior islam istanbul mosque muslim religion spirituality turkey turkishculture turkiye worship yenicami yenimosque
Istanbul, The City ..... (Mine Beyaz) Tags: city blue water turkey cityscape turkiye istanbul mosque cami deniz mavi skyscaper turkei 5photosaday abigfave aplusphoto gokdelen flickrlovers minebeyaz
Lleburgaz Sokullu Mehmet Paa Camii adrvan (Metin Canbalaban) Tags: city trip travel vacation cloud holiday turkey trkiye trkei cami soe mehmet turkije turquia tyrkiet turchia turkki turkei turkiet tyrkia osmanl krklareli adrvan paa sokullu tyrkland mywinners abigfave luleburgaz platinumphoto anawesomeshot sokollu superbmasterpiece diamondclassphotographer ysplix theunforgettablepictures lleburgaz metincanbalaban ottomanstyle luleburgazphoto sokullumehmetpaa
Ortaky, Before Sunrise! (~caner) Tags: turkey trkiye istanbul mosque turquie trkei cami bosphorus boazii estambul turqua turkki   canercangl ortakybykmecidiyecamii seyyidabdlhalimefendi
Bosphorus and Ortaky Mosque - stanbul - Turkey (serkanizm_83) Tags: sea turkey trkiye istanbul mosque cami bosphorus turkei ortaky 333v3f 222v2f 444v4f 111v1f boaziikprs
Cami and Dunston (grandylion) Tags: friends rabbit bunny polaroid sx70 la polaroids cami hold dunston
 (gzkbs) Tags: turkey turkiye cami ankara bayram ulus haci hacbayram hacibayram
Mezquita Nueva - Yeni Cami - New Mosque - Cpulas (www.pedroferrer.com) Tags: canon turkey photography eos 350d photographer islam trkiye istanbul mosque turquie trkei dome mezquita ottoman cami cupulas hdr turquia fotgrafo techo azulejos estambul columna moschea mosque fotografa turchia   yenicami iznik moschee newmosque osmanl bizancio constantinopla  mezquitanueva   istanboul   ottomanstyle  islamicdome fieraz pedroferrer fierazgmailcom t httppedroferrerfotografiablogspotcom pedroferrerfotografia
Kocatepe Mosque... (Nejdet Duzen) Tags: trip travel cloud turkey minaret islam capital religion trkiye mosque ottoman cami ankara din hdr minarets bulut camii minare kocatepe seyahat osmanl bakent mywinners abigfave platinumphoto anawesomeshot impressedbeauty islamicbuildings overtheexcellence goldstaraward ottomanstyle
Tacones lejanos (Manikii fotografas ) Tags: yo cami camilaarias
Hagia Sophia, I S T A N B U L (yonca60) Tags: night turkey landscape nightshot minaret istanbul mosque cami hagiasophia ayasofya agiasophia thegalaxy panoramafotogrfico nikond5000 theoriginalgoldseal mygearandme mygearandmepremium mygearandmebronze mygearandmesilver mygearandmegold flickrstruereflection2 flickrstruereflectionlevel1 yoncaevren rememberthatmomentlevel4 rememberthatmomentlevel1 rememberthatmomentlevel2 rememberthatmomentlevel3 me2youphotographylevel2 me2youphotographylevel1 hagiasophiawithnightview
Sultan Ahmed mosque!! (Mansour Ali) Tags: architecture turkey day cloudy islam istanbul mosque sultan cami ahmed masjid   islamic sultanahmet  estambul
Turkey - Istanbul - Beikta district - European bank of the Bosphorus - Ortaky Mosque at Dusk - Blue Hour - Twilight ( Lucie Debelkova / www.luciedebelkova.com) Tags: ocean old city trip travel bridge people building tourism monument beautiful horizontal architecture night turkey religious outdoors temple boat asia europe view place dusk minaret islam religion sightseeing scenic culture places istanbul images mosque tourist east journey vista destination local recreation scape cami exploration eastern turkish strait bosphorus minarets attraction islamic touristic bosphorous camii bosporus ortakoy ortaky moschee sakralbau minarett luciedebelkova boporus wwwluciedebelkovacom
Rumb al Gran Buda / The Path of the Great Buddha (SBA73) Tags: wood tree nature japan forest arbol honeymoon earth path kamakura roots natura bosque nippon terra cami arbre nihon jap bosc japn raices arrels  anawesomeshot viatgedenoces colourartaward greatbuddhapath
 ar  The Message  (Zleyha Sucu) Tags: sky people message minaret muslim pray mosque arabian cami salah dua insan gkyz minare namaz ar azan ezan mussulman mesaj haydi mslim mslman fotorafkraathanesi aplusphoto haydiferaha hayyalessalah hayyalelfelah haydinamaza mosleam
Kocatepe Mosque Ankara/Turkey (painter&draftsman) Tags: turkey cami ankara kocatepe
Kutsal (alemdag) Tags: alemdag trabzon trkiye turkey cami minare mart gull mosque panasonic gkyz krmz mor platinumphoto freephotos theunforgettablepictures damniwishidtakenthat isawyoufirst lesamisdupetitprince mehmetalemda fz50 fotoraf sanat renkler yeil sar mavi turuncu tutku colourartaward landscape macro action portrait flickrenvyni cubism lumixaward mehmet alemda turkiye
I love football - Istanbul (belthelem) Tags: trip travel turkey children nikon child d70 dove trkiye d70s istanbul mosque turquie trkorszg trkei mezquita palomas lovelovelove cami futbol nio breathtaking turquia viajar estambul camii t100 tirkiye themoulinrouge yenicami newmosque turco mezquitanueva 10faves ltytr1 a3b ryc4x2 belthelem oraclex
Layers of History - Explore #35 (Yavuz Alper) Tags: tower tram bazaar cami pasa mosques minarets firetower tramvay minare kule kulesi nuruosmaniye beyazt gazi cemberlitas yangn atikali
Day 225/365 (ayeme thong) Tags: park blue light portrait sky white black hot green field grass skinny back sticks bush day shadows tank purple head top circles over navy cream sunny ground dot jeans faded stuff flare flannel 365 spine plaid left cami 225
Eski Cami (B@ni) Tags: motif turkey kodak trkiye mosque turquie trkei calligraphy cami turkije turquia tyrkiet edirne turchia turkki z740 turkiet tyrkia oldmosque tyrkland eskicami fotografca
The Majestic Courtyard - (Istanbul, Turkey) (blame_the_monkey) Tags: travel architecture night turkey istanbul bluehour portfolio cami sultanahmet sultanahmed blamethemonkey elialocardi
cami (Andrew Litsch) Tags: portrait beach nikon photographer florida fort miami south drew andrew lauderdale cami d40 litsch strobist drewshoots
The Blue Mosque - Istanbul, Turkey (blame_the_monkey) Tags: old travel architecture night turkey muslim istanbul historic bluehour portfolio bluemosque cami minarets sultanahmet sultanahmed blamethemonkey elialocardi
Antalya... (Nejdet Duzen) Tags: travel sea reflection history turkey boat harbour yacht trkiye mosque antalya cami deniz soe sandal yat akdeniz tatil yansma turkei seyahat tarih kaleii yivliminare yatliman mywinners abigfave anawesomeshot theunforgettablepictures goldstaraward vosplusbellesphotos hliday


page:          1        2        3 
size:     -      

50 cami 33 turkey 29 mosque 26 istanbul 18 türkiye 16 travel 14 architecture 11 türkei 10 turchia night blue 9 minaret sultanahmet turkiye estambul 8 turquie sky islam sea 7 mezquita nikon religion camii anawesomeshot turquia hdr 6 turkki osmanlı minare sunset trip ottomanstyle muslim 5 theunforgettablepictures light turkei minarets islamic color aplusphoto abigfave city ottoman turkiet tyrkland red bosphorus törökország turkije landscape tyrkiet bulut tyrkia 4 kuzeytac canoneosdigitalrebelxti mavi tirkiye ayasofya explore deniz twilight sultanahmed renkler purple eminonu art evening mosquée moschea history dome leyla bluemosque lsi bridge historic cloud canoneos400d longexposure tarih boat colour 3 viajar orange asia panasonic silhouette lights nocturna platinumphoto dusk nature south tourist イスタンブール bluehour turquía d70 トルコ renk sun a3b building arabian ortakoy europe t100 colourartaward reflection tourism мечеть d70s yenicami touristic old moschee colors モスク panoramafotográfico monument mimari belthelem view portfolio court ankara تركيا sultan gökyüzü courtyard ortaköy mywinners portrait wideangle temple icono superaplus nippon mygearandmesilver 25faves 清真寺 wind artistic unitedarabemirates urban moon geotag galata mygearandmebronze iznik dubai turcja investment fz35 europa andrew sirfranciscankerjones people λάρνακα visit استانبول tarihi japón abudhabi goldstaraward kulesi crude arenzano best 10faves mehmet geotagged mygearandme tower lumix tarihiyarımada pacocabezalopez photographer sandal peninsula elialocardi middleeast emea larnaca κύπροσ kule oil arabic gcc hour bosc yoncaevren leica أبوظبي‎ green yellow drewshoots impressive mygearandmegold mosques emirates detail florida ocean arches zs7 field blamethemonkey kocatepe sheikhzayedmosque kırmızı eminönü इस्तांबुल ssjgeorge texture panorama flare mezquitanueva coran photography nighshot vivid 100commentgroup supershot landmark fz38 seafront mygearandmepremium diamondclassphotographer турция genişaçı lucena tree colores day sarayburnu skyline तुर्की petrodollar persiangulf wood scape path مسجدالشيخزايد d40 cityscape القرآنالكريم vibrant copyrightedallrightsreserved ไก่งวง newmosque ever bosque tz10 visiting seyahat ışık goldenhorn hagiasophia forest nuit ltytr1 japan uae bosphorous notte beşiktaş clouds themoulinrouge litsch icon japó cyprus 伊斯坦布尔 sigma1020 strobist ryc4x2 canon brown canon70300isusm magic 土耳其 ysplix turki ayatollah soe beach ترکیه nihon breathtaking handmade place picture shine mekan lesamisdupetitprince minebeyaz shore oriental φεγγάρι detay ratcliff hat autumn turska boporus fagano architectur luces linda palace pintado haydinamaza

Pairs: 9 cami,turkey 6 cami,istanbul istanbul,turkey architecture,cami architecture,istanbul architecture,turkey 4 cami,travel architecture,travel mosque,turkey istanbul,travel architecture,sultanahmed

Users: Kuzeytac 4 blame_the_monkey belthelem 3 Andrew Litsch SBA73 Nejdet Duzen Manikiií fotografías ✿ yonca60 ssj_george Sir Francis Canker Photography © Celalettin Güneş gzkbs Kıvanç Niş Züleyha Sucu serkanizm_83 WWW.BEROK.ES Bilal K maistora grandylion Metin Canbalaban painter&draftsman Mine Beyaz alemdag B@ni lachance ~caner Mansour Ali Yavuz Alper orgutcayli www.pedroferrer.com Fenanov canbalci ayeme thong Stuck in Customs


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.