abstract art artistic atmosphere avantgarde bizarre blackandwhite cinematic city color colorful cool design emotions experimental experiments expressionist eyes face fashion fotografca fotografeshqiptare fotografkiraathanesi fun independentphotos lifestyle light marielito me modern odd palabra people photography portrait psychological square strange style surreal texture tones urban weird wow

avantgarde Flickr Hive Mind Users: DerrickT Eni Turkeshi Imagery pumpkincat210 livinginacity Ben Heine ! . © Angela Lobefaro . ! Edward Olive Actor Photographer Fotografo Madrid ROBERTLASKA.COM farbspiel RYANLEETURTON. Patrick Matte (more)  Preferences 
 Favorites   Groups   Interestingness   Recent   Tags   Text   User   Advanced 

I am a fan of Nicole Atkins's Music. Check her out!

-Nathan

 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://flickrhivemind.net/Tags/avantgarde Hits: 31747 Pages: 635 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
Steve Jobs (Ben Heine) Tags: life california portrait usa art history apple face businessman computer painting macintosh design eyes imac technology ipod graphic circles internet interface workinprogress fame creative machine competition itunes screen disney next management electronics pixar wifi revolution future ceo winner stevejobs expressive stevewozniak inventor series mathematics inventions genius coverage innovation macosx shape director manager recognition tablet billgates touchscreen charisma honors ordinateur career avantgarde portrayal iphone philanthropy ipad gnie cercles appleinc perfectionist successstory stevenpauljobs benheine appstore digitalcirclism pancreasneuroendocrinetumor
chess room:) (Eni Turkeshi Imagery) Tags: urban texture wall modern artistic expression quality trkiye lifestyle style narrow interiordesign depth aliceinwonderland avantgarde urbangeometry marielito fotografkiraathanesi top25faves fotografeshqiptare ithinkthisisart independentphotos flickritik theperfectphotographer fotografca photocaleidoscope 1000invitational toiletentry nuvolemind fshenderr portfoliourban
mac cosmetics rainbow eyeshadow fake eyelashes on a green eye (pumpkincat210) Tags: usa beauty fashion geotagged fun photography rainbow mac colorful texas extreme makeup houston style greeneyes cosmetics eyeshadow fakeeyelashes avantgarde eotd dreamglow rainboweyeshadow courtneyrhodes pumpkincat210
City of Arts and Sciences - Valencia, Spain (HDR Panorama) (farbspiel) Tags: travel vacation panorama holiday tourism water valencia architecture modern clouds photoshop photography pond spain nikon cloudy cyan wideangle journey blended handheld architektur stitching photomerge nikkor stitched dri hdr highdynamicrange futuristic spanien blend avantgarde ciudaddelasartesylasciencias valncia postprocessing dynamicrangeincrease 18200mm lhemisfric d90 photomatix lumbracle digitalblending cityofartsandsciences tonemapped tonemapping ciutatdelesartsilescincies detailenhancer topazadjust topazdenoise klausherrmann topazsoftware topazphotoshopbundle nikonafsdxnikkor18200mm13556gedvr
Avant-garde hairstyle (AnyMotion) Tags: flowers plants macro floral frankfurt ngc blumen poppy makro 2008 hairstyle soe papaver avantgarde excellence mohn themoulinrouge naturesfinest anymotion 50faves 1mill mywinners theworldisbeautiful platinumphoto anawesomeshot ourplanet infinestyle diamondclassphotographer flickrdiamond thatsclassy betterthangood goldstaraward damniwishidtakenthat obq avantgardehairstyle fhope phvalue bestofblinkwinners
Contessa 2007 - Avant-Garde (Patrick Matte) Tags: woman canada fashion contest hairstyle 2007 avantgarde finalist contessa vftw
Fotgrafo de boda Edward Olive    Wedding photographer Madrid Barcelona London Paris - bride and groom - fotografia artistica en bodas madrid (Edward Olive Actor Photographer Fotografo Madrid) Tags: madrid bw film canon happy eos 1 cool spain kiss 85mm romance bn class special vip l chic weddings feliz moment elegant capture expired cinematic clase romantico ef matrimonio beso bodas novios especial avantgarde f12 joyeux gluck bisoux bigday sposati unconventional marie mariages refinement edwardolive casaments legance nadacuteyhorteradetodalavidafotografiadebodasenespaa
Mr. Collage-Man's Orbly Stare (DerrickT) Tags: selfportrait me strange scarf fun weird experiments funny experimental mask surreal oxygen sequence comical papermache avantgarde thesoftenergythatfollowshimswiftly theideatobecomeacollage itallstartswiththis likeacosmicconversation tuckedbetweenthefoldsofmymind butterfliesonmyface twohandsforeacheyebrow selfcollaged
Gehry's Spiral (livinginacity) Tags: new city urban toronto canada building museum architecture modern buildings wow wonderful spiral design cool stair transformation superb contemporary unique awesome surreal gehry architect wicked staircase scifi civic ago rebirth sublime urbanism frankgehry  recent pritzger addition spiralstaircase joyous expansion avantgarde institutional artgalleryofontario sensuous   mathmatics spiralling   somethingnew   idiosyncratic reorganization archidose  transformationago gehrypartners mathmatica  a pritzgerprize
The ROM at Night: a thing of brave beauty? (livinginacity) Tags: lighting new city light toronto canada abstract reflection geometric museum modern night wow wonderful evening design cool superb crystal abstractart awesome prism surreal canadian illuminated wicked reflective civic colourful elegant sublime rom luminous  architettura recent royalontariomuseum daniellibeskind joyous avantgarde institutional danielliebeskind prismatic crystalline   disorienting contemporaryarchitecture liebeskind     idiosyncratic archidose arkitect  arkitekture goldenphotographer colourlicious coloricious  arkitecten a architectureincanada visipix
Stair of Wonders (livinginacity) Tags: new city light toronto canada abstract reflection geometric museum wow wonderful design cool superb crystal abstractart awesome prism canadian wicked reflective civic rom luminous  architettura recent royalontariomuseum escaleras joyous ern avantgarde institutional danielliebeskind prismatic crystalline   disorienting contemporaryarchitecture liebeskind     idiosyncratic arkitect  arkitekture  arkitecten a architectureincanada
Ebullient Eye-opener Inside of A Jagged Ladder's Cerebellum (DerrickT) Tags: strange weird peekaboo nophotoshop eyeopener avantgarde multivision loudsilencessurroundinghumanartifacts glassespoke ladderletsmecurlupinsideofitsribcage derrickhasmanyfangirlsiampleasedtobeonemyself saysolive
ambient 4 (dedalus11) Tags: blue light red stilllife orange brown white abstract color colour macro rot art glass colors beautiful field yellow closeup catchycolors photography photo interestingness artwork focus colorful soft colours photographer photographie dof close image photos bokeh kunst creative silk blurred images depthoffield gelb impressionism softfocus shallow braun macros closeups makro coolest photoart depth glas tabletop tabletops silky closer muted avantgarde shallowdepthoffield macrophotography abstrait shallowdof makros macroshots abstrakte closeshots nahaufnahmen creativetabletopphotography dedalus11 anawesomeshot impressedbeauty ccmpsharp bokehwhores bokehwhoresweek02finalist
Cottonmouth (DerrickT) Tags: me strange weird experiments funny experimental surrealism surreal bowl odd cotton bizarre tpc avantgarde cottonmouth avantgardephotography tpcu14 tpcu14l4
A Potency For Unknown 'Knowns' (DerrickT) Tags: blackandwhite strange mystery amber weird experimental sister surreal odd bizarre avantgarde psychological abigfave dontthinkofitasbeingwhatyouthinkitmaybeordontthinkitis becauseitmaycomebackandbiteyouonthebuns ohhowiloveit imustadmitthatithinkthatitlovesmeaswell somewhatofapanicbutnotreally tensionbehindthewindow somethingthathappenedbeforethis impressedbeauty
Conditional Probability, With A Third Ear (DerrickT) Tags: blackandwhite glasses experiments experimental eating elderly hungry portfolio greataunt avantgarde vegetablesoup psychological thinskin throughbooleanalgebraicquantities portraitsandtheirmathematicalstates thefinitestatemachinedefinedintheroleofhumanityastheprobabilityofdeathcomputedlysits theuncommonspace homagesherecentlypassedaway2009 dwcffbw
Existing Behind Us (DerrickT) Tags: weird experiments artistic uncle experiment odd creation figure portfolio phantom bizarre avantgarde psychological thereweredelicatesensorsbetweeneachearandwhenheswallowedhewonderedwherethewindwouldtakehim behindusasensibledelicacyofwonder theexistencedividedbyemotion
The Sophistication of Mr. Lamp-shade (DerrickT) Tags: strange wonderful fun weird insane crazy funny surreal odd lampshade bizarre avantgarde myuncle lampshadehead weirdisalwayswonderful mrlampshadeiswaitingtodrinkteawithyou sittinginarockingchairinthekitchen totallyunexpectedbutthenagainitneveris etceterac ifyouthinkititcanbedone
The Umquhile Shadow-Paraphernalia With Hands-on Ripening (DerrickT) Tags: light blackandwhite strange face dark surrealism odd form cinematic avantgarde lightexperiments alackofteetotum theengineeringofsplendor shadowslikecrimpedvertebrae mimyzelfandeye thelinesontheleftsacrificialarteriesstrippedtoanartificialmap thethresholdofsoundlessmotionlessleaping minglingwithin
Self- Reached Within The Internal rching (DerrickT) Tags: blackandwhite selfportrait art me strange photography weird experiments artistic surreal shades odd vision ethereal monkeys dreamy experimentation surrealistic within avantgarde andhappy happinesscomesfromwithin reachandbefree allmanualallmanualexperimentationasusual likeapostmodernclusterofaccountability annihilateyourinternalstruggle imnotaverage butimmodest conceptualisms orism internalarching andyesthatsmyhand
Neurobical Ambience (DerrickT) Tags: blackandwhite clock portfolio vaseline psychology avantgarde unwarranted abigfave themeaningisrightatyourdoorstep orbackdoor orevenrightnexttoyou clockdown timeloop seperatingthemindssoftwarefromitshardware
The Uncertain Stability of Two Subjects In A Catastrophe (DerrickT) Tags: blackandwhite odd avantgarde whiteandblack longtermexposure bifurcation indefinitedivisibility dynamicpsychology amirroranditslowreflectiveimbalance inverselyproportional repititionofduality becomingtheimmovableobject thedarkenedmirror reflectsunoperatablemotion disappearingequilibria
Work in Progress - Steve Jobs (Ben Heine) Tags: life california portrait usa art history apple face businessman computer painting macintosh design eyes imac technology ipod graphic circles internet interface workinprogress fame machine honor competition evolution itunes screen disney next management electronics pixar wifi revolution future ceo winner stevejobs expressive stevewozniak inventor mathematics inventions genius coverage innovation macosx shape director manager recognition tablet billgates making touchscreen charisma ordinateur career avantgarde portrayal iphone philanthropy ipad gnie cercles appleinc perfectionist successstory stevenpauljobs benheine appstore digitalcirclism pancreasneuroendocrinetumor
The Long and Winding Road | Valdorcia Edition (! .  Angela Lobefaro . !) Tags: road abstract colors long colours hill pop hills popart cielo andywarhol fields warhol cypress lonely winding valdorcia rolling allrightsreserved lonetree weltkulturerbe avantgarde asciano antiart angiereal angelamlobefaro riproduzioneriservata
Hamburg (Flaf) Tags: art station pencil drawing main hamburg hauptbahnhof florian mitte dco avantgarde elbphilharmonie grnderzeit neoklassizismus kulturcaf mnckebergstrase wilhelminismus afflerbach
mac bronze eyeshadow (pumpkincat210) Tags: usa eye beauty fashion bronze geotagged fun photography colorful texas extreme makeup houston style mascara eyeshadow avantgarde maccosmetics dreamglow courtneyrhodes pumpkincat210
Carbon Black M.A.C. Eyeshadow Smokey Eyes (pumpkincat210) Tags: black eye art beauty fashion fun photography colorful extreme makeup greeneyes greeneye mascara smoky eyeshadow avantgarde maccosmetics sexyeyes dreamglow smokyeyeshadow maceyeshadow blackeyeshadow smokeyeyeshadow carboneyeshadow pumpkincat210 yogurteyeshadow felineeyeliner plushlashmascara sexyeyeshadow
Self-Anfractuosity From The Enveloping Principles of Nature (DerrickT) Tags: blackandwhite hidden obscure avantgarde isuppose abigfave somelightisfittobeeaten youllfindyourfortuneinovertimesaidbillieholiday inthiscasemyfortuneisinbravingtheleavesofnaturesintrepidswagger butopposing withproseandleafyinstruction onesfloccinaucinihilipilificationcansometimesmakeyouwanttobecomethethingorsubjectthatisbeingjudgedbyanother oftenoverlookedisthefashionofearthsessence nophotoshopyetagain manualized whatiamtobeiamnowbecoming andtheprocessofbecoming nourisheswhatyouwillbecome
offering a shelter ! (Eni Turkeshi Imagery) Tags: city portrait people urban color texture abandoned face vintage turkey lost warm dof artistic grunge citylife lifestyle atmosphere istanbul poetic memory expressionist nostalgic melancholy cinematic emotions tones fugees oblivion feelings storytelling avantgarde palabra nostalghia oldiesbutgoldies aod hbw marielito abigfave fotografkiraathanesi fotografeshqiptare independentphotos trashbit fotografca indiefamily
Obra da Torre de TV Digital de Braslia, projeto de Oscar Niemeyer (Xavier Donat) Tags: sky tower braslia arquitetura brasil architecture digital design tv construction df torre tour symbol monumento grand wideangle historic moderne future antena diffusion projeto technique numrique obra televiso brsil chantier tlvision distritofederal avantgarde projet smbolo bton transmisso sigma1020mm oscarniemeyer sobradinho cartopostal esthtique difuso tlcommunications flordocerrado atrao innovant sinaldigital avantgardiste torredetvdigital digitaltvtower
Somnambulist (DerrickT) Tags: strange mirror weird eerie bizarre avantgarde sleepwalking psychological disordered typicaltypical disambiguation darkeyednoctambulism uncleagain youreafreakingeniusboyolouxxx
photograph (RYANLEETURTON.) Tags: lighting blue shadow portrait male green apple studio hands indoor human trippy psychedelic futuristic 2012 avantgarde
Derrickatu, Phantom der Nacht: The Hunger (DerrickT) Tags: lighting blackandwhite white black me self weird experiments experimental moi eerie creepy hunger taste fangs stark thirst bizarre vampyre avantgarde psychological deftone imaddictedtolighting imaddictedtoart orperhapsiamthefuturebugsbunnyha addicteditellya quenchthou andnotwithcarrots haveimentionedthatiamaddictedtolifeandtoartandeverythinginbetween okenoughofthat tagscanbefriendly wheresmylucy shebetternotbeoffonadatewithunclefesterorsomeone therearebetteronesinthefuture thenailsareintheworksandwellsoiseverythingelse itsonlyamatteroftime beforemyeyestwistintoastiroffountains liketheoldcomics
Crucified By Multi-colored Effulgences (DerrickT) Tags: light color me by weird hand odd bizarre handful avantgarde havingfun psychological crucified artlibre idturnmyselfintograpeseedoilforyou crucifiedbythelipbalmoflightsspookychill fixion justdoingwhatevercomestomindfirstwithoutpausingtothinkabouthoworwhyorwhere myrazorisdull metallockjawfacehead irreplaceablehand thegreengrapesourfulheadgeartorturetechniqu
The Subreption of A Chess-Player Gone Mad (DerrickT) Tags: blackandwhite strange weird insane surrealism chess surreal eerie creepy odd mysterious bizarre avantgarde psychological myuncle themodelofweirdology
desperate urban absorption (Eni Turkeshi Imagery) Tags: life city light shadow portrait people urban selfportrait abstract color detail reflection texture me face self square eyes artistic habit citylife lifestyle atmosphere palace steam attitude soul expressionist reality conceptual cinematic emotions restricted absorbed eni avantgarde routine palabra urbanite aod afterthought marielito artlibre fotografkiraathanesi top25faves fotografeshqiptare independentphotos trashbit fotografca fshmelankoli indiesurrealism fshae
Torre Agbar 1/2 (arturii!) Tags: barcelona city blue windows red summer sky hot window architecture composition photoshop wow eos amazing interesting arquitectura europa europe foto view superb awesome capital cel center catalonia fave finestra architect vista leds vermell catalunya blau hdr torreagbar artur catalua barcelone gettyimages calor ciutat estiu avantgarde rascacielos gratacels simetria jeannouvel catalogne glories barcelons falico photomatix impresive referencia golddragon 400d supositori platinumphoto anawesomeshot aplusphoto arquitecte arturii 2canon solarcontrol detallessculpturalandaechitecturaltreasures goldenvisions skygreaper avanguarda
hasselblad haze (Edward Olive Actor Photographer Fotografo Madrid) Tags: world madrid original light espaa art film de photography cool spain focus gallery mood different photographer dof arte artistic photos unique fineart fine galeria olive banco atmosphere retro professional edward pointofview lumiere simplicity myworld pelicula artistica expired diferente universe tableau imagenes feelings fotografo stockphoto avantgarde imagebank cuadro artistico ambiente artistique argente fotosartisticas fotografiaartistica lluz caducado edwardolive fotografomadrid photographermadrid madridfotografos commercialphotographers fotografoprofesionalmadrid galeire fotograi photosbyedwardolive fotostomadasporedwardolive fotografoscomerciales gettyiberiasummer professionalphotographerspain
c'era una volta il uest:) (Eni Turkeshi Imagery) Tags: old sea sky mountain texture window clouds train artistic perspective lifestyle style atmosphere nostalgia albania emotions avantgarde sergioleone enniomorricone klauskinski contrats supershot marielito passionphotography abigfave fotografkiraathanesi colorphotoaward fotografeshqiptare diamondclassphotographer independentphotos betterthangood trashbit gianmariavolonte leevanclif fshnsh
The Portrait of Re-conditioned Chance (DerrickT) Tags: blackandwhite strange happy weird experiments experimental experiment odd bizarre greataunt avantgarde elemental tablemanners whatthehay hippitydooda myohmywhatawonderfulsiteshesays partofmyvisual lastonefromthisgreataunteatingatthetableseries bubblespopped shrunkenheadblues
The Subreption of A Chess-Player Gone Mad, 1 1/2 (DerrickT) Tags: strange weird experiments insane experimental surrealism uncle chess surreal odd concept bizarre avantgarde psychological ornot yetagain myuncle morethanwhatmeetstheeye
Three Cypresses | Valdorcia edition (! .  Angela Lobefaro . !) Tags: abstract colors colours kunst hill pop hills popart cielo andywarhol fields warhol cypress lonely valdorcia rolling trilogy allrightsreserved lonetree trilogie weltkulturerbe avantgarde asciano trilogia antiart angiereal angelamlobefaro riproduzioneriservata imnotaphoto
we are not always what we try to show (Eni Turkeshi Imagery) Tags: light portrait people rolleiflex project print square published artistic atmosphere expressionist paintingwithlight series analogue cinematic emotions avantgarde palabra altprocess liquidemulsion marielito fotografeshqiptare independentphotos wearenotalwayswhatwetrytoshow palanr35 indiedesperation fshfv
we are not always what we try to show (Eni Turkeshi Imagery) Tags: light shadow portrait people mediumformat square artistic atmosphere expressionist analogue cinematic emotions decadence 100asa avantgarde palabra marielito artlibre fotografeshqiptare independentphotos fomafilm rolleiflexplanar35 indiedecadence
o p i u m II (Eni Turkeshi Imagery) Tags: portrait people face square eyes mood artistic nostalgia expressionist cinematic emotions tones opium 30s avantgarde palabra altprocess liquidemulsion marielito artlibre fotografeshqiptare independentphotos fshenderr
istanbul diaries III (Eni Turkeshi Imagery) Tags: park city light people urban color texture turkey square artistic pavement magic grunge citylife photojournalism lifestyle atmosphere istanbul nostalgia expressionist cinematic emotions vignetting tones fugees avantgarde palabra besiktas beikta thecontinuum marielito fotografkiraathanesi top25faves fotografeshqiptare independentphotos bvirds fotografca dostr indiedreamland
La Bohme (Eni Turkeshi Imagery) Tags: light portrait people bw face studio eyes opera artistic character atmosphere mimi expressionist paintingwithlight format analogue elegant largeformat 9x12 sinar avantgarde puccini labohme newspaperdress marielito fotografeshqiptare independentphotos fotografca fomafilm
poetic windows from a forgotten era (Eni Turkeshi Imagery) Tags: city people urban color history texture window wall vintage warm citylife photojournalism lifestyle palace poetic spooky communism memory era expressionist balkans stories cinematic emotions tones cultures narrative touching 2b fact avantgarde aod marielito pogradec guriikuq fotografeshqiptare independentphotos trashbit autumninside fotografca
Miss S/M Panna S/M (ROBERTLASKA.COM) Tags: original portrait blackandwhite black celebrity art robert rock rolleiflex portraits photography photo punk photographer photoshoot image fine creative culture poland polska polish professional photomontage punkrock editorial famouspeople prints celebrities fotografia portret warszawa zdjecia avantgarde d photogallery laska celebrityphotographs editorialportrait
More goodies (AisleOne) Tags: typography type specimen avantgarde alanfletcher bobgill colinforbes stempelhaas herblubalinflickrexportdemo


page:          1        2        3 
size:     -      

50 avantgarde 13 weird 12 artistic 11 light blackandwhite strange odd 10 fotografeshqiptare bizarre portrait marielito independentphotos 9 cinematic surreal 8 people city expressionist psychological atmosphere art experiments photography emotions 7 experimental face 6 urban me palabra design lifestyle color fotografca texture abstract 5 cool abigfave square eyes fotografkiraathanesi fun 4 citylife wonderful colorful style surrealism fashion wow trashbit canada awesome architecture artlibre tones modern usa superb 3 建設 colours insane 建筑物 future selfportrait beauty museum pumpkincat210 photographer extreme reflection creative colors black institutional funny 建筑师 civic 建築物 portfolio anawesomeshot recent spain 建築師 建设 nostalgia blue life makeup analogue sky eyeshadow lighting eerie toronto aod elegant aрхитектура 加拿大 window history dreamglow 建築 top25faves 架构 new apple wicked 架構 idiosyncratic dof joyous shadow myuncle inventor wall mascara experiment makro platinumphoto stevenpauljobs lonely workinprogress eye disorienting warm fomafilm maccosmetics madrid houston professional prismatic screen coverage hairstyle fine asciano greataunt next director pancreasneuroendocrinetumor happy turkey danielliebeskind macosx benheine perfectionist film architect greeneyes white interface cielo ipad graphic focus ordinateur imac touchscreen career manager red photomatix pixar fugees iphone eos diamondclassphotographer mood arkitecten génie courtneyrhodes luminous liquidemulsion self appleinc innovation depth chess successstory andywarhol inventions ©angelamlobefaro geometric royalontariomuseum crystal painting bw warhol hill management hdr istanbul grunge lonetree unique palace ipod abstractart winner fshenderr macintosh creepy revolution california series popart vintage edwardolive machine original geotagged photo paintingwithlight circles expressive tablet appstore architectureincanada ceo prism feelings canadian studio charisma portrayal stevejobs crystalline fame allrightsreserved architettura poetic angiereal weltkulturerbe rolling memory shape expired altprocess stevewozniak technology computer recognition rolleiflex billgates image rom internet hills wifi futuristic photoshop arkitekture impressedbeauty uncle macro antiart philanthropy liebeskind reflective kunst itunes fields valdorcia clouds sublime genius texas contemporaryarchitecture cercles riproduzioneriservata arkitect businessman pop mathematics archidose digitalcirclism cypress wideangle photos betterthangood photojournalism competition disney electronics papermache makros símbolo bisoux thatsclassy mrlampshadeiswaitingtodrinkteawithyou andtheprocessofbecoming unwarranted tablemanners jeannouvel nuvolemind theuncommonspace itallstartswiththis darkeyednoctambulism myohmywhatawonderfulsiteshesays smoky glories thelinesontheleftsacrificialarteriesstrippedtoanartificialmap gehrypartners theideatobecomeacollage fact indiefamily silky indefinitedivisibility oldiesbutgoldies

Pairs: 6 avantgarde,blackandwhite 5 strange,weird avantgarde,weird avantgarde,strange 4 psychological,weird bizarre,strange bizarre,weird 3 strange,surrealism odd,strange psychological,strange strange,surreal

Users: DerrickT 18 Eni Turkeshi Imagery 10 pumpkincat210 3 livinginacity Ben Heine ! . © Angela Lobefaro . ! Edward Olive Actor Photographer Fotografo Madrid ROBERTLASKA.COM farbspiel RYANLEETURTON. Patrick Matte Flaf ¡arturii! Xavier Donat AisleOne dedalus11 AnyMotion


Fiveprime.org supports The Mountain Institute - Sustaining mountain people, cultures and environments through education, conservancy, and sustainable development.