animal animalia animals beak beautiful bill biology bird black blue brown canada canon cat closeup color colorful creature dive fauna feathers green life light macro marine natural nature nikon ocean organism photo photography photos portrait red sea spring travel water white wild wildlife wing zoology

animal,life  Flickr Hive Mind (more)  Preferences  Flickr Hive Mind is on a new server and FAST. Some bugs with international characters are now completely fixed. Blackmagic has been replaced with an in-page viewer. I hope everything is working. -Nathan
 Favorites  Groups  Interestingness  Recent  Tags  Text  User  Advanced 
 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind. If you log into Flickr you will see your private photos and larger thumbnails. Where do these thumbnails come from? How are the photos licensed?
Chasco-cinzento / Chasco-do-monte (Oenanthe oenanthe) (Mark & Cy Photos) Tags: angle animal animalia arts background beast bird blue blurred chats composition crafts effect environmental exterior feather flycatchers focus format framing front genre grass horizontal landscape life light lighting misc natural northern oenanthe old orientation outdoor passeriformes photo photography plant pole post profile setting sky skyline style time travel vegetation view vignette weather wheatear wild wildlife wooden worldobjectmiscpoleposttimeweatherblueskyplantvegetationgrassartscraftsphotographyeffectvignettesettingskylineexterioroutdoorphotogenrewoodenstyletypewildlifetravelorientationlandscapelightingnaturallightframingcompositio
Goldfinch (hakoar) Tags: life red portrait brown white black bird eye nature animal yellow closeup fauna standing espoo finland pose bill colorful pattern looking wildlife goldfinch tail leg watching wing beak feathers finch balance fi posture staring stance plumage cardueliscarduelis passerine
idol grace (BarryFackler) Tags: ocean life sea fish nature water ecology animal sport coral fauna outdoors island hawaii polynesia bay marine underwater pacific being dive scuba diving sealife pacificocean tropical marinebiology diver bigisland aquatic reef creature biology undersea kona saltwater tropicalfish ecosystem coralreef marinelife vertebrate zoology seacreature moorishidol marineecology organism 2015 hawaiianislands honaunau konacoast hawaiicounty kihikihi southkona hawaiiisland honaunaubay sandwichislands marineecosystem westhawaii zancluscornutus konadiving bigislanddiving hawaiidiving sealifecamera barryfackler barronfackler zcornutus
Oma & Leo (Laura__0000) Tags: campo cnelvidal bw dog pet cachorro oma jugando playing animal canon city goldenretriever puppy perro mascota cuatropatas animales amonganimals explore lifestyle town life black blackandwhite favorite favoritas friends fun peopleargentinacitycanonlifefavoritefavoritasgentehang outpeopleargentinamar del platapersonexplorelife style people gente light monocromatico monochrome coronelvidal argentina person countryside field candid documenting mylifeinshots everydaylifeshot hangout mardelplata perros dogs animals popular faves popularfaves gggg blancoynegro publico white monocromatica gris blanco negro shot persona human image spontaneous photography photos buenosaires amoryfascinaciónporlavida argentinosfotografiando dogsiloveyou
Captivity: human bestiality (Zoo Berlin) (Samuele Deiana fidelio86) Tags: life portrait blackandwhite bw elephant berlin nature animal germany sadness freedom nikon alone cage bn solo animali badness germania vita captivity elefante libertà berlino solitudine berlinzoo cattività cattiveria zoodiberlino samueledeiana httpwwwflickrcomphotosfidelio86
af1612_0001 (Adriana Füchter) Tags: canon adrianafuchter füchter colours photography art creative round colourful photo naturaleza folhagem serenidade árvore orgânico natureza life flower spring colour fall passarinho ave pássaro bird pardal animal cantante fauna littlebird
Seagull (Scott Alan McClurg) Tags: life blue wild sky cloud bird water beautiful animal mall happy fly flying pretty wildlife seagull parking flight wing feather lot sunny neighborhood suburb fowl float graceful flap soar smallbirds glide
Mamá leona (Víctor Bautista) Tags: life africa parque wild animal animals fauna cat canon tanzania big natural leo kenya five lion safari leon vida cachorro 7d felino gran animales cubs cachorros serengeti aventura bigfive leones leona panthera manada crias llanura salvaje 100400 dzoom felido
20110820_159_138 Pony jumping at Göteborgs Fältrittklubb _ Gothenburg, Sweden _ Solero 33 & Elina Mellberg (ratexla) Tags: life horses people horse favorite cute sports beautiful animal animals sport göteborg person cool jump jumping europe sweden earth gothenburg contest competition human pony ponies sverige scandinavia rider equestrian animalplanet humans scandinavian riders goteborg showjumping tellus palomino homosapiens häst organism tävling nonhumananimals ponny hästar 2011 equuscaballus tippen gsgs hoppning europaeuropean tävlingar almostanything hopptävlingar nonhumananimal hopptävling unlimitedphotos equusferuscaballus ponnyer canonpowershotsx10is göteborgsfältrittklubb gfrk isabellfärgad photophotospicturepicturesimageimagesfotofotonbildbilder 20aug2011
Darevskia derjugini (ganglionn) Tags: life wild macro art nature ecology animal animals fauna canon turkey eos us photo kiss all dragon image photos reptile wildlife türkiye picture sigma photographic lizard turquie türkei dslr predator 70300mm makro biology lizards turkije animalia trabzon herpetology turquía turchia x3 トルコ turkki 500d reptilia xpress varanus turkiet chordata turecko bilateria deuterostomia vertebrata gnathostomata tetrapoda squamata rudis durana toruko turcia eukaryota lacertidae yomra eumetazoa apodg lacertinae colorphotoaward varanid τουρκία tуpция flickrunitedaward teoki darevskia
upload (LiChen.7) Tags: leica colours blu green nature landscape art animal life
2_DSC7182 (dmitry_ryzhkov) Tags: lazirky poltavskaoblast ukraine color colour colourful colours colorful colors nature naturephotography life naturelife spring geotagged light live photo photography photos sony dmitry ryzhkov village moment moments closeup shot shots macrophotography close closeupphotography animal animals insect insects
Black-headed gull (hakoar) Tags: life red portrait brown white black bird eye nature animal closeup fauna mouth espoo finland bill colorful call looking adult wildlife gull beak yawn scream fi screaming alert blackheadedgull chroicocephalusridibundus
Eurasian tree sparrow (hakoar) Tags: life portrait brown black bird eye nature animal closeup fauna female espoo finland pose grey bill colorful pattern looking wildlife small leg wing beak feathers sparrow fi stance passermontanus eurasiantreesparrow passeriformes passerine
orangutan and comforter (tsaiian) Tags: life trees wild portrait nature face animal forest sumatra indonesia fur zoo monkey eyes rainforest wildlife borneo orangutan primate animalia mammalia pongo primates orangutans pygmaeus chordata hominidae ponginae federationofmalaysia
The White Lion King (praja38) Tags: life wild white ontario canada tree male nature animal animals female cat mammal oak eyes feline wildlife caps hamilton lion humour canadian safari shade predator lioness mane whitelion capricorn africanlionsafari
murena (Mario.Pesce www.mariopesce.com) Tags: ocean life travel blue school red sea wild vacation fish color tree nature water beauty animal silhouette swimming silver jack outdoors photography mackerel freedom togetherness fishing marine underwater natural image background space wildlife group scuba safety anchovies tropical environment leisure recreation tuna sardine copy herring active shoal fishery destinations fisheries
lost end (dendik_photography) Tags: ocean life travel blue camping newzealand sky sun white snow green beach nature water animal sand forrest earth feel berge adventure alpine seal nz moment sonne reise
_MG_3317bas1 (Mark Strain.) Tags: life wild nature animal animals june female canon feeding wildlife worm blackbird animalia wildbirds markstrain
grizzley-Khutzeymateen-0767 (Mike Taddeo) Tags: ocean life camera wild summer canada bird classic mike water look rain birds animal alaska canon river private lens photography see fly photo wings nikon tour bc eagle feeding photos o wildlife watch wing bald feather it canadian safari alpine raptor e u british tours flap rupert eagles raptors hear photogaphy
Osprey Flying With a Fresh Catch (Scott Alan McClurg) Tags: life wild sky fish bird nature animal forest fly flying back spring fishing backyard wildlife hunting flight bluesky neighborhood raptor gliding flapping flap osprey carnivore naturephotography glide
DSC_0074 (Marco Micheli) Tags: life italy dog pet cute beauty grass animal cane wonderful photography photo reflex nice nikon italia day shot pics piano picture erba primo cap tuscany capture toscana animali luce bellezza setter cani obiettivo d90 soggetto istantanea 18140 istante nikond90
De algún instinto animal (Lucas Croce) Tags: life wild horse argentina animal digital canon caballo eos buenosaires bavio 60d
A Proud Animal (ahmadtalha1987) Tags: life street pakistan nature animal camel
downy-woodpecker-50.jpg (Scott Alan McClurg) Tags: life wild male bird animal woodpecker downywoodpecker wildlife feeder eat perch downy suet
Flying Bee - Abeja volando (www.ignaciolinares.com) Tags: life flowers red summer plant flower color colour macro green texture textura field grass leaves animal closeup bug garden insect spring close view bees small insects drop bee mosquito honey campo ladybug blossoming pollen abeja bicho invertebrate zoology arthropod insecto pollinate mariquita pollination texturized polinización texturizado ignaciolinares
DSC_0029 (chriskg5) Tags: life africa wild nature beautiful animal zoo hungary budapest magyar amneville
Dunnock (Hayley.price Photography) Tags: life wild house bird nature animal animals price photography natural photos wildlife photograph sparrow hayley aralia
holly cow (jrockar) Tags: life travel people urban 6x6 tourism beautiful animal mobile square cow photo phone shot burma snapshot documentary cell snap domestic temples instant myanmar moment everyday bagan iphone 5s nyaungu hipstamatic instagram fltrlive
Red-winged blackbird. that seems to like a string (Scott Alan McClurg) Tags: life winter red wild black bird animal flying backyard fighter wildlife wing feathers feeder neighborhood eat angry perch hungry feed flapping flap blackbird suet smallbirds argue redwinged
 (Patricia Mellin) Tags: life friends nature animal animals joy djur naturen uiversum
The Alien in My Garden (MynickisNick) Tags: life plant nature beautiful field animal closeup garden insect leaf amazing dof sony alien january alpha dslr depth 2014 a290 dslra290 sonydslra290
Today's cat 2014.1.16 (ladious666) Tags: life animal cat alive catsplanet
Tiger, Toronga Zoo (PaulKillenPhotos) Tags: life wild animal animals paul photography zoo tiger sydney australia toronga killen
 (LisaBSkelton) Tags: life nature animal canon mammal marine wildlife tail dive whale humpback migration nelsonbay portstephens fluke baleen whaletail cetacean 60d tailflukes lisaskelton
splashing aroung (The Happy Household) Tags: life family blue light summer dog pet playing color tree male travelling green love dogs wet water pool grass animal playground fauna female fence puppy fun toy outside happy photography living jump mixed sand friend collie play oz expression colorphotography young australia running excited playfull dogface mate mixedbreed femaledog exciting bridle laugther pawl lifewalks playfullanimals
Today's cat 2013.8.31 (ladious666) Tags: life animal cat catsplanet
Mute Swan (alyrees) Tags: life city uk summer england plants sun white west green nature water leaves weather animal river neck bristol photography photo leaf swan pond nikon long lily natural bright farm south beak reserve dslr creature mute pads eastwood d3100
quail eggs (Zoryanchik) Tags: life food brown white holiday color macro bird cooking nature up animal closeup breakfast easter cuisine spring healthy raw pattern close natural nest symbol little background object traditional small egg group shell tasty nobody fresh gourmet health meal eggs organic diet product protein quail eggshell delicatessen nutritious ingredient fragility
Pheasant phight ! (Curiosity thrills.) Tags: pheasant common ring neck phasianus colchicus brittish scottish bird birds wild life nature natural world history fight fighting 2 two minigaff moor galloway south west scotland aves avi fauna avian exotic spat rumble wing wings winged feathers birdlife pure simple animal free beaky water forest woodland garden country side
20120831_1 Cute wart-biter cricket (Decticus verrucivorus) | Gothenburg, Sweden | Click downward arrow for more size options (ratexla) Tags: life favorite macro cute green nature beautiful animal animals yellow göteborg insect cool europe paint sweden earth wildlife gothenburg norden insects cricket sverige scandinavia polyptych makro biology insekt animalplanet scandinavian 2012 invertebrate invertebrates 1000views goteborg zoology tellus djur grön organism nonhumananimals nordiccountries catchycolorsgreen insekter pentaptych vårtbitare europaeuropean nonhumananimal decticusverrucivorus wartbiter ryggradslösadjur photophotospicturepicturesimageimagesfotofotonbildbilder canonpowershotsx40hs 31aug2012
big guys (BarryFackler) Tags: ocean life sea nature water ecology leaves animal coral fauna mammal island hawaii polynesia bay marine underwater pacific dolphin being dive scuba diving sealife pacificocean dolphins tropical marinebiology diver bigisland aquatic reef creature biology undersea kona naia ecosystem coralreef marinelife vertebrate zoology seacreature spinnerdolphins marinemammals marineecology organism cetaceans honaunau konacoast leafgame odontoceti hawaiicounty southkona hawaiiisland 2013 honaunaubay stenellalongirostris marineecosystem westhawaii hawaiianspinnerdolphins konadiving bigislanddiving hawaiidiving slongirostris sealifecamera barryfackler barronfackler
Phyllidia varicosa (BarryFackler) Tags: life sea nature water ecology animal coral fauna island hawaii polynesia bay marine underwater pacific being dive scuba diving sealife pacificocean tropical marinebiology diver nudibranch bigisland aquatic reef creature biology undersea kona mollusc ecosystem coralreef mollusk invertebrate marinelife zoology seacreature seaslug organism honaunau konacoast hawaiicounty southkona hawaiiisland 2013 phyllidiavaricosa marineinvertebrate honaunaubay westhawaii konadiving friedeggnudibranch bigislanddiving hawaiidiving sealifecamera varicosephyllidia barryfackler barronfackler pvaricosa
Otter (JKonradsen Photography) Tags: life nature water animal fur eyes wildlife otter
مصابيح مساجد مصر القديمه (M.Atef90) Tags: life light portrait people panorama man flower color macro home animal photography boat photo still photographer natural tools bee lighter damitta
Gorilla (ericneitzel) Tags: escondido california unitedstates usa wap animal park zoo sandiego cheetah fast running fastestlandmammal fourlegged nikon nikkor ericthomasneitzel eric thomas neitzel ericneitzel etneitzel erictneitzel ericthomasneitzelphotography ericneitzelphotography d200 ©ericneitzel ©ericthomasneitzel kitt kitty safaripark lion africa wildlife wild wildanimalpark esco bigcat cat kitten cats large run sd diego san county life northcounty north nikkon
Just another day in the Arcata Bottoms (MetalMooseBoy) Tags: life california blue smile animal rural happy cow milk humboldt farm tan farmland bottoms livestock humboldtcounty stampede distraction farmlife happycows rurallife arcatabottoms humboldtcows
Grey Whale tail (phrase!) Tags: ocean life travel sea sun canada water animal vancouver mammal island grey spring interesting nikon warm open wildlife tail watching sunny columbia adventure explore sound tofino whale british wilderness nikkor migration creature vr dx clayoquot 18105mm d7000
melanerpes carolinus, red-bellied woodpecker (hakoar) Tags: life family portrait tree bird eye nature animal fauna standing pose relax us bill colorful pattern looking florida wildlife unitedstatesofamerica leg wing beak feathers stare northamerica rest resting redbelliedwoodpecker stance melanerpescarolinus
Miss Frog, Parc de la Mauricie, Québec, Canada (monsieur I) Tags: world life travel canada nature water animal animals quebec frog mauricie nohuman lacsacacomie lumixdmclx3 monsieuri nationalparklamauricie

page:  1   2   3 
size:  - 

Hivemind: http://flickrhivemind.net/Tags/animal,life Hits: 89608 Pages: 1793



50 life animal 29 nature 21 wildlife 18 wild 14 bird 13 water 12 photography fauna animals 9 photo 8 natural canon 7 white portrait wing closeup 6 green blue spring ocean nikon travel color beautiful 5 feathers creature light macro beak organism biology zoology red sea photos marine cat colorful black 4 animalia people bill scuba ecology mammal canada shot flap female tropical sky eye summer insect grass pattern brown looking zoo dive island tree underwater 3 male coralreef undersea fish sealifecamera feather honaunau sun happy forest hawaiiisland konacoast bay hawaii plant seacreature being pacific barryfackler marinelife flower westhawaii fi southkona leaves pose background small image coral reef favorite marinebiology pacificocean africa leg dslr

Pairs: 13 animal,life 8 life,nature 6 animal,nature life,wild animal,wild 5 animals,life 4 life,wildlife 3 nature,wild animal,wildlife animals,wild animal,animals

Users: hakoar 4 Scott Alan McClurg BarryFackler 3 ratexla ladious666 dmitry_ryzhkov Adriana Füchter Patricia Mellin Mike Taddeo phrase! LiChen.7 www.ignaciolinares.com Mark & Cy Photos praja38 LisaBSkelton PaulKillenPhotos ericneitzel alyrees Mario.Pesce www.mariopesce.com tsaiian ganglionn monsieur I jrockar JKonradsen Photography chriskg5 Samuele Deiana fidelio86 ahmadtalha1987 The Happy Household MetalMooseBoy Curiosity thrills. MynickisNick Lucas Croce dendik_photography Laura__0000 Marco Micheli M.Atef90 Víctor Bautista Zoryanchik Mark Strain. Hayley.price Photography