100thbirthday 18801980 1980 1980s 2014 2015 35mm 3e 4july 4th 4thofjuly america aspen aspencentennial blonde celebration centennial color colorado day dewolf family festivities film fireworks fourthofjuly holiday independence independenceday july july4 july4th kids lake nick nickdewolf night nikon parade party people photographbynickdewolf red reel3e summer

4thofjuly  Flickr Hive Mind (more)  Preferences  Flickr Hive Mind is on a new server and FAST. Some bugs with international characters are now completely fixed. Blackmagic has been replaced with an in-page viewer. I hope everything is working. -Nathan
 Favorites  Groups  Interestingness  Recent  Tags  Text  User  Advanced 
 Recent   Interesting   Timeline 

Welcome to Flickr Hive Mind. If you log into Flickr you will see your private photos and larger thumbnails. Where do these thumbnails come from? How are the photos licensed?
IMG_3825 (Marcelo David) Tags: usa america fireworks 4thofjuly independenceday
Brick Building (itsclarasphotography) Tags: clara city blue red baby cute brick green beautiful america laughing happy fire photography freedom photo nikon nebraska downtown fireworks smoke exploring bricks july pregnant pop boom mo adventure kansascity missouri laugh works prego kc 4thofjuly celebrate crackle bump wander kcmo julyfourth westbottoms smokebomb merica raelynn babybump maccoy kcmophotographer itsclara itsclarasphotography
View from the bench (US Department of State) Tags: sports illinois july4th 4thofjuly july4 independenceday 4july girlssports womenssports
4th of July parade (Flickr_Rick) Tags: summer holiday outside parade 4thofjuly manti
Fourth of July (Dave's Domain) Tags: party independence day fireworks campfire kids people night madeff112514 independenceday fourthofjuly 4thofjuly
Fourth of July (Dave's Domain) Tags: independenceday fourthofjuly 4thofjuly
Fourth of July (Dave's Domain) Tags: independenceday fourthofjuly 4thofjuly
Happy 4th of July (75/365) (sdobie) Tags: hands fireworks sparklers 100views 200views 365 4thofjuly project365 2013
1966 SS 396--DSC00025--Port Orford, OR (Lance & Cromwell back from a Road Trip) Tags: 20164thofjuly 4thofjuly 4thofjulyjubilee 2016 parade portorford highway101 currycounty oregon oregoncoast sony sonyalpha ss396 chevy chevrolet 1966 chevelle musclecar supersport
Happy Birthday USA - 04-July-2016 (Cesar - 32photos) Tags: holiday nikon fireworks galaxy nikkor july4th 4thofjuly lagalaxy d800 nikkor2470mmf28 nikond800 galaxyfc
Mommy, Auntie, Sissy, Shy Cousin Joan, and Me (JohnnyM112) Tags: easternshore va md 4thofjuly
Independence Day BBQ (2016) (a.Jones photo.Graphy) Tags: people candid candidphotography girl girls outdoor outdoors streetphotography pool swimming summer summertime kids kid teen teenager teenagers splash wet water squirtgun watergun splashing 4thofjuly bbq poolparty ajonesphotography
Kaboom Town 2 (FLIGHTLEVELPHOTO) Tags: holiday texas fireworks aircraft airshow 4thofjuly addison dlf kaboomtown davidfranks cavanaughflightmuseum wwwflightlevelphotocom flightlevelphotography flightlevelphotoicloudcom wwwflightlevelcom
Stars, bars, and explosions (micah.goff) Tags: fireworks lake night 4thofjuly longexposure
P1140514 (MFTMON) Tags: party holiday dale 4thofjuly dalemorton mftmon
Cadets Drum & Bugle Corps (Mark Sardella) Tags: summer massachusetts parade 4thofjuly independenceday wakefieldma cadetsdrumbuglecorps wakefieldindependencedayparade
2015 D-Backs 4th of July (BigMac12121983) Tags: stadium fourthofjuly 4thofjuly ballpark mlb arizonadiamondbacks coloradorockies majorleaguebaseball chasefield 2015majorleaguebaseballseason
La Verne's 4th of July Fireworks (Trent Bell) Tags: california airport fireworks socal 4thofjuly laverne 2015 brackett
Huntley, IL Fireworks (topmedic) Tags: birthday park longexposure chicago colors america illinois nikon northwest fireworks celebration suburb recreation openspace explosions 4thofjuly july4 camille claudine nightexposure timing 2015 d7000 tokina1114 acefireworksshooter
IMG_9075 (roxfan) Tags: fourthofjuly 4thofjuly fireworks party friends family independenceday canon 70d eos
Jesse & Kyla!! (~EverFashionista216~) Tags: world red black hair coast model doll university dolls texas jean northwest native head 04 no label goddess ken barbie collection american blonde 4thofjuly raven atm basics mattel 002 collector fashionistas
American soul (Zeke Anders) Tags: leica losangeles streetphotography americanflag patriotic american fourthofjuly hollywoodblvd july4th 4thofjuly july4 patriotism independenceday redwhiteblue julyfourth leicacamera hollywoodboulevard zekeanders leicadlux109 leicadluxtyp109
Meet at the Monument (US Department of State) Tags: sunset summer washingtondc fireworks flags summertime july4th 4thofjuly july4 independenceday crowds picnics 4july
2014-07-05 (79) fireworks for the 4th (JLeeFleenor) Tags: photos photography md celebration display fireworks 4thofjuly oceancitymd holiday maryland
3e-299 (ndpa / s. lundeen, archivist) Tags: boy summer people color film boys kids 35mm children centennial colorado child fireworks nick ivan july aspen july4th 4thofjuly 1980 1980s festivities westend 100thbirthday dewolf 3e 4thofjulyfireworks nickdewolf photographbynickdewolf 18801980 dewolfhome reel3e aspencentennial
3e-246 (ndpa / s. lundeen, archivist) Tags: summer people woman man color film face hat 35mm centennial costume colorado picnic dress faces nick july blond blonde aspen july4th 4thofjuly 1980 1980s festivities youngwoman 100thbirthday dewolf 3e nickdewolf photographbynickdewolf 18801980 riograndepark reel3e aspencentennial
3e-131 (ndpa / s. lundeen, archivist) Tags: summer people horse woman color film face hat 35mm centennial costume colorado nick july parade blond blonde aspen july4th 4thofjuly 1980 1980s festivities youngwoman 100thbirthday dewolf 3e 4thofjulyparade nickdewolf photographbynickdewolf 18801980 reel3e aspencentennial
3e-059 (ndpa / s. lundeen, archivist) Tags: summer people signs color film sign race 35mm centennial colorado nick july running trail numbers runners aspen july4th 4thofjuly runner 1980 1980s 100thbirthday bibs dewolf 3e nickdewolf photographbynickdewolf riograndetrail 18801980 fivemilerace aspenglo reel3e aspencentennial aspenglofive
4July2014-56 (4x4Foto) Tags: family beach pool fun maria brayden vabeach joanna savannah 4thofjuly 2014 sandbridge benwhite melissawhite kathyreesey larryreesey kaylareesey
4th of July Weekend - Maine and RI (dsgray16) Tags: vacation maine 4thofjuly vinalhaven
2014 Independence Day Fireworks (Zadok Photo) Tags: us day fireworks 4th july firework independence 4thofjuly independenceday of
Riverside, Illinois 4th of July 2014-010 (riverside.illinois) Tags: summer riverside watertower parade townhall suburbs 4thofjuly 2014 calvertvaux chicagosuburbs nationalhistoriclandmark fredericklawolmsted arcadebuilding riversideillinois 2010s riversidewatertower metrariverside friendsofthe4thofjuly riversideillinoisphotos peopleofriversideillinois peopleofriverside riversideresidents riversideillinoisresidents
La Verne's 2014 4th of July Parade (Trent Bell) Tags: california military parade vehicles socal 4thofjuly 2014 laverne
Independence Day 2014 (WestPointBand) Tags: july4th 4thofjuly westpoint unitedstatesmilitaryacademy trophypoint westpointband
Fourth of July (Dave's Domain) Tags: party independence day fireworks campfire kids people night madeff112514 independenceday fourthofjuly 4thofjuly
4th of July 2014 -- DSC09746 (Lance & Cromwell back from a Road Trip) Tags: oregon oregoncoast 4thofjuly portorford 2014 currycounty 4thofjulyjubilee fireworks2014
fireworks at balloon fiesta park from corrales (johngpt) Tags: fireworks event 4thofjuly tpfskytheme fromcorrales fujinonxf1855mmf284rlmois fujifilmxt1
Fourth of July Extravaganza (pt. 2) 39 (FilmandFocusPhoto) Tags: green yellow sparkles night outdoors fireworks fourthofjuly 4thofjuly sparks todayspic
2014 Fireworks (75).jpg (Johnny Barnes) Tags: fireworks hamilton fourthofjuly 4thofjuly independenceday 2014 firewoks butlercounty hamiltonohio soldierssailorsandpioneersmonument
_DSC0517 (Eli Mergel) Tags: blue red party white flag neworleans 4th nola 4thofjuly kolossos kreweofkolossos
Brooklyn Heights - Macy's Fireworks 2014 -11 (Kelly Hafermann Photography) Tags: nyc newyorkcity ny newyork skyline brooklyn view fireworks manhattan july brooklynheights 4thofjuly july4 independenceday 0704 2014
20140704 DC Netherlands Carillon Park036 (Dan_Girard_Photography) Tags: arlington virginia districtofcolumbia unitedstates fireworks lincolnmonument 4thofjuly monuments washingtonmonument statecapital 2014 dangirardphotography
Fourth of July Fireworks (Aurora Santiago Photography) Tags: seattle fireworks fourthofjuly 4thofjuly gasworkspark
IMG_6759 (drjeeeol) Tags: katie fav triplets 4thofjuly 2014 5yearsold
4th of July fireworks 2014 (Bobby Joe Pace Jr) Tags: fireworks tennessee 4thofjuly 2014 chapelhilltennessee bobbyjoepacejr
4th 6 (mmphotography1) Tags: usa lake color reflection water night nightscape fireworks olympus celebration 4thofjuly omd em5 getolympus
Oh say, can you see (creativegenius5) Tags: fireworks nightshots 4thofjuly
Abstract Fireworks (3//Josiah) Tags: light lightpainting abstract brooklyn crazy fireworks unique special negative paintingwithlight portfolio 4thofjuly 2014 minipirate josiahshelton josiahsheltonphotography
NYC Macy's Fireworks Show, July 4, 2014 (26 of 73) (Diacritical) Tags: nyc fireworks spot macys f80 july4th 4thofjuly independenceday 82mm 70200mmf28 nikond4 25secatf80 july42014 94151pm
4th of July Parade 2014 (City of Fort Collins, CO) Tags: family food lake kids america fun fireworks fort flag families 4th july fortcollins pride parade cheer 4thofjuly fourth collins celebrate 2014

page:  1   2   3 
size:  - 

Hivemind: http://flickrhivemind.net/Tags/4thofjuly Hits: 522429 Pages: 10449



50 4thofjuly 27 fireworks 14 independenceday 11 2014 10 fourthofjuly july4th 9 summer 8 july 7 people parade 5 party holiday kids july4 night color 4 film photographbynickdewolf 35mm centennial colorado 1980 nickdewolf aspen aspencentennial nick 100thbirthday america 1980s 3e dewolf 18801980 reel3e 3 celebration nikon 4th lake independence day blonde festivities red family summertime illinois woman photography currycounty blue fun brooklyn oregoncoast american madeff112514 green julyfourth campfire 2015 outdoors md face socal portorford pool northwest usa oregon hat california youngwoman blond costume nyc texas longexposure flag streetphotography water laverne 4thofjulyjubilee celebrate 4july

Pairs: 20 4thofjuly,fireworks 8 fireworks,independenceday 4thofjuly,independenceday 7 4thofjuly,fourthofjuly 6 fireworks,fourthofjuly 2014,4thofjuly 5 fireworks,night 4thofjuly,holiday 4thofjuly,night 4thofjuly,party 4thofjuly,july4th

Users: Dave's Domain 4 US Department of State Lance & Cromwell back from a Road Trip Trent Bell johngpt drjeeeol Bobby Joe Pace Jr Aurora Santiago Photography FLIGHTLEVELPHOTO sdobie FilmandFocusPhoto BigMac12121983 MFTMON Cesar - 32photos 4x4Foto riverside.illinois Zadok Photo WestPointBand a.Jones photo.Graphy Marcelo David topmedic Zeke Anders micah.goff Kelly Hafermann Photography JohnnyM112 Johnny Barnes Flickr_Rick dsgray16 Dan_Girard_Photography mmphotography1 ~EverFashionista216~ creativegenius5 roxfan Mark Sardella itsclarasphotography City of Fort Collins, CO Eli Mergel JLeeFleenor Diacritical